Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NCS3

Protein Details
Accession A0A2A9NCS3    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
23-42GVTSKNKNVKKPRGGKKATVHydrophilic
77-99GDGTAPSKSRSKPRPKKNKVQDLHydrophilic
NLS Segment(s)
PositionSequence
28-66NKNVKKPRGGKKATVAKSNENGDTEPKKAPAKRKGRPPK
83-95SKSRSKPRPKKNK
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MGSTPSTSGPSSASTSKEDIALGVTSKNKNVKKPRGGKKATVAKSNENGDTEPKKAPAKRKGRPPKEVQSEDNEPQGDGTAPSKSRSKPRPKKNKVQDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.24
4 0.23
5 0.2
6 0.16
7 0.15
8 0.14
9 0.11
10 0.12
11 0.16
12 0.16
13 0.2
14 0.28
15 0.3
16 0.38
17 0.48
18 0.55
19 0.61
20 0.7
21 0.77
22 0.8
23 0.8
24 0.76
25 0.75
26 0.75
27 0.69
28 0.65
29 0.57
30 0.51
31 0.5
32 0.48
33 0.4
34 0.31
35 0.28
36 0.25
37 0.24
38 0.22
39 0.19
40 0.19
41 0.23
42 0.26
43 0.34
44 0.4
45 0.48
46 0.53
47 0.63
48 0.71
49 0.75
50 0.8
51 0.79
52 0.8
53 0.8
54 0.78
55 0.7
56 0.66
57 0.64
58 0.57
59 0.53
60 0.43
61 0.32
62 0.28
63 0.25
64 0.19
65 0.13
66 0.13
67 0.14
68 0.14
69 0.18
70 0.23
71 0.27
72 0.37
73 0.46
74 0.56
75 0.62
76 0.72
77 0.81
78 0.86
79 0.92