Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9ND80

Protein Details
Accession A0A2A9ND80    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MMHCFPFKKVKKTQPNSGTGFFHydrophilic
NLS Segment(s)
PositionSequence
66-66K
70-76KTKISRP
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MMHCFPFKKVKKTQPNSGTGFFYVAPGYKLSMEEIHKVQSKNFNTNSYAEELRRKELFALRKLPPKSVDKTKISRPRPLRPPQNEVVLHYDNHIRLYRKYINSLQLDNHVRLYRQHIVQLKKREEKRRATELAQWRYNERLSQREQDEAWNILQHLKRKQRYEDLRAKKRQDEEIWTTIQHLKRKERYEDLRTKRRQDYARSHAYQIETLTCNLEYHPDLRRSLLKDPKNRFLTWLRGGVQLLEKYGWSISNKERNRFQHSLNGNYIPFEIAEQFLPLAKTWKDLQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.8
4 0.74
5 0.66
6 0.56
7 0.5
8 0.39
9 0.31
10 0.24
11 0.19
12 0.16
13 0.13
14 0.14
15 0.13
16 0.13
17 0.14
18 0.18
19 0.2
20 0.23
21 0.24
22 0.29
23 0.34
24 0.34
25 0.36
26 0.41
27 0.43
28 0.47
29 0.49
30 0.47
31 0.44
32 0.45
33 0.43
34 0.38
35 0.37
36 0.3
37 0.35
38 0.33
39 0.35
40 0.34
41 0.32
42 0.32
43 0.36
44 0.41
45 0.4
46 0.45
47 0.45
48 0.53
49 0.53
50 0.54
51 0.52
52 0.51
53 0.51
54 0.54
55 0.57
56 0.56
57 0.6
58 0.66
59 0.71
60 0.69
61 0.71
62 0.69
63 0.7
64 0.73
65 0.77
66 0.78
67 0.74
68 0.77
69 0.71
70 0.72
71 0.63
72 0.55
73 0.52
74 0.44
75 0.37
76 0.31
77 0.31
78 0.23
79 0.25
80 0.26
81 0.21
82 0.2
83 0.28
84 0.34
85 0.32
86 0.37
87 0.39
88 0.43
89 0.44
90 0.44
91 0.38
92 0.37
93 0.38
94 0.34
95 0.33
96 0.26
97 0.23
98 0.23
99 0.28
100 0.26
101 0.24
102 0.28
103 0.31
104 0.37
105 0.43
106 0.51
107 0.52
108 0.55
109 0.62
110 0.67
111 0.69
112 0.71
113 0.72
114 0.7
115 0.67
116 0.61
117 0.61
118 0.61
119 0.6
120 0.55
121 0.48
122 0.41
123 0.4
124 0.38
125 0.33
126 0.25
127 0.23
128 0.23
129 0.28
130 0.28
131 0.28
132 0.28
133 0.27
134 0.27
135 0.23
136 0.19
137 0.14
138 0.13
139 0.16
140 0.18
141 0.2
142 0.26
143 0.34
144 0.39
145 0.42
146 0.46
147 0.52
148 0.57
149 0.62
150 0.64
151 0.66
152 0.71
153 0.74
154 0.74
155 0.69
156 0.65
157 0.62
158 0.55
159 0.52
160 0.48
161 0.44
162 0.41
163 0.36
164 0.35
165 0.33
166 0.34
167 0.31
168 0.31
169 0.36
170 0.43
171 0.48
172 0.51
173 0.55
174 0.59
175 0.64
176 0.69
177 0.7
178 0.73
179 0.73
180 0.75
181 0.72
182 0.72
183 0.68
184 0.67
185 0.67
186 0.65
187 0.69
188 0.64
189 0.6
190 0.56
191 0.51
192 0.43
193 0.34
194 0.3
195 0.21
196 0.19
197 0.19
198 0.16
199 0.15
200 0.13
201 0.15
202 0.13
203 0.14
204 0.2
205 0.22
206 0.22
207 0.25
208 0.3
209 0.31
210 0.39
211 0.46
212 0.48
213 0.54
214 0.6
215 0.67
216 0.67
217 0.63
218 0.6
219 0.56
220 0.56
221 0.52
222 0.51
223 0.43
224 0.41
225 0.41
226 0.37
227 0.37
228 0.29
229 0.26
230 0.2
231 0.18
232 0.16
233 0.16
234 0.18
235 0.14
236 0.19
237 0.26
238 0.36
239 0.42
240 0.48
241 0.56
242 0.6
243 0.67
244 0.66
245 0.61
246 0.6
247 0.6
248 0.61
249 0.57
250 0.55
251 0.46
252 0.42
253 0.4
254 0.31
255 0.24
256 0.19
257 0.15
258 0.12
259 0.12
260 0.11
261 0.11
262 0.13
263 0.14
264 0.13
265 0.17
266 0.16
267 0.2