Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2A9NAK5

Protein Details
Accession A0A2A9NAK5    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MIVSQGKGKRKKGKDNGKKCTNCKQDGHydrophilic
NLS Segment(s)
PositionSequence
7-17KGKRKKGKDNG
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MIVSQGKGKRKKGKDNGKKCTNCKQDGHLIEDCYWKGGGKEGQLPWDKKKEKSSANTASTPTSDNNDVSLAVTYGTSESLQALTSSPPHDEAIIDCSAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.9
3 0.91
4 0.92
5 0.91
6 0.85
7 0.85
8 0.83
9 0.78
10 0.7
11 0.65
12 0.64
13 0.58
14 0.58
15 0.5
16 0.43
17 0.38
18 0.38
19 0.33
20 0.24
21 0.21
22 0.16
23 0.13
24 0.15
25 0.15
26 0.14
27 0.19
28 0.19
29 0.25
30 0.31
31 0.33
32 0.33
33 0.4
34 0.41
35 0.39
36 0.45
37 0.45
38 0.45
39 0.48
40 0.53
41 0.52
42 0.53
43 0.52
44 0.47
45 0.41
46 0.36
47 0.33
48 0.24
49 0.19
50 0.17
51 0.15
52 0.15
53 0.14
54 0.13
55 0.12
56 0.11
57 0.08
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.08
70 0.08
71 0.11
72 0.12
73 0.13
74 0.15
75 0.15
76 0.15
77 0.15
78 0.15
79 0.17