Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q1K730

Protein Details
Accession Q1K730    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
66-88QGAYRLKPKRTIPKKLGAKKTGDHydrophilic
317-342TEKVGSRKAKFRARRRRRNTFLLGIKHydrophilic
345-375KLAKADRREEYRRRVREKREQRLVQRKEFLABasic
NLS Segment(s)
PositionSequence
70-85RLKPKRTIPKKLGAKK
321-447GSRKAKFRARRRRRNTFLLGIKERKLAKADRREEYRRRVREKREQRLVQRKEFLAKQREAKKAREGGAAAEKSEKKEVKAEKPAAAAPKVEKPKAPEAAKKESKPKVEEKKAAAAEPKKDSKTEKKD
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncr:NCU08861  -  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences MHLAQLRQPLTRAAANSCHSVCRLPTTHSSVSATAILSEQFAHLRIGPSSSNVAVEGRRYASVKAQGAYRLKPKRTIPKKLGAKKTGDQYVIPGNIIYKQRGTLWHPGENTIMGRDHTIHAAVAGYVKYYRDPQLHPDRQYIGVVFNRNDKLPYPKDAPRKRKLGLVAVPRKVEEVEKPTMSASGLPLFVTRHETIEIPPPAVTTPAAAGKAVKGQGARVSASGAAAVPASSSTISASASSNSNNGGSSVIAELIKEKLAARAEYNARQSALRKLQQQKMLARRGTRVLRLMNNYSYRETNWEIGRLIGDPGSVPGTEKVGSRKAKFRARRRRRNTFLLGIKERKLAKADRREEYRRRVREKREQRLVQRKEFLAKQREAKKAREGGAAAEKSEKKEVKAEKPAAAAPKVEKPKAPEAAKKESKPKVEEKKAAAAEPKKDSKTEKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.39
4 0.37
5 0.36
6 0.33
7 0.34
8 0.31
9 0.32
10 0.32
11 0.31
12 0.37
13 0.43
14 0.44
15 0.44
16 0.46
17 0.38
18 0.38
19 0.34
20 0.27
21 0.2
22 0.18
23 0.15
24 0.12
25 0.12
26 0.11
27 0.1
28 0.11
29 0.12
30 0.13
31 0.15
32 0.15
33 0.17
34 0.16
35 0.18
36 0.2
37 0.19
38 0.18
39 0.17
40 0.18
41 0.16
42 0.18
43 0.18
44 0.17
45 0.19
46 0.2
47 0.2
48 0.25
49 0.31
50 0.33
51 0.31
52 0.32
53 0.37
54 0.4
55 0.44
56 0.48
57 0.49
58 0.49
59 0.55
60 0.61
61 0.65
62 0.7
63 0.75
64 0.73
65 0.74
66 0.82
67 0.84
68 0.86
69 0.82
70 0.78
71 0.73
72 0.73
73 0.69
74 0.6
75 0.5
76 0.43
77 0.43
78 0.37
79 0.32
80 0.24
81 0.18
82 0.22
83 0.24
84 0.23
85 0.18
86 0.18
87 0.2
88 0.25
89 0.29
90 0.33
91 0.35
92 0.39
93 0.38
94 0.39
95 0.37
96 0.34
97 0.3
98 0.23
99 0.19
100 0.14
101 0.14
102 0.14
103 0.14
104 0.14
105 0.13
106 0.11
107 0.1
108 0.1
109 0.09
110 0.09
111 0.07
112 0.07
113 0.08
114 0.08
115 0.09
116 0.12
117 0.17
118 0.2
119 0.21
120 0.3
121 0.4
122 0.47
123 0.49
124 0.5
125 0.47
126 0.44
127 0.44
128 0.35
129 0.28
130 0.25
131 0.26
132 0.23
133 0.26
134 0.26
135 0.26
136 0.26
137 0.24
138 0.28
139 0.27
140 0.32
141 0.32
142 0.37
143 0.48
144 0.56
145 0.64
146 0.64
147 0.68
148 0.64
149 0.63
150 0.6
151 0.57
152 0.54
153 0.55
154 0.56
155 0.52
156 0.52
157 0.47
158 0.44
159 0.36
160 0.31
161 0.24
162 0.21
163 0.22
164 0.21
165 0.21
166 0.21
167 0.21
168 0.19
169 0.16
170 0.11
171 0.09
172 0.09
173 0.08
174 0.09
175 0.09
176 0.09
177 0.14
178 0.13
179 0.12
180 0.13
181 0.14
182 0.14
183 0.22
184 0.22
185 0.17
186 0.17
187 0.16
188 0.15
189 0.15
190 0.14
191 0.06
192 0.07
193 0.08
194 0.08
195 0.08
196 0.08
197 0.08
198 0.1
199 0.11
200 0.11
201 0.09
202 0.1
203 0.12
204 0.13
205 0.13
206 0.11
207 0.11
208 0.1
209 0.09
210 0.09
211 0.06
212 0.05
213 0.04
214 0.04
215 0.03
216 0.03
217 0.04
218 0.03
219 0.04
220 0.04
221 0.04
222 0.05
223 0.06
224 0.06
225 0.07
226 0.08
227 0.08
228 0.08
229 0.09
230 0.09
231 0.08
232 0.08
233 0.07
234 0.06
235 0.06
236 0.06
237 0.06
238 0.06
239 0.06
240 0.06
241 0.07
242 0.07
243 0.07
244 0.07
245 0.09
246 0.11
247 0.12
248 0.12
249 0.17
250 0.21
251 0.24
252 0.27
253 0.25
254 0.24
255 0.24
256 0.25
257 0.27
258 0.32
259 0.32
260 0.37
261 0.44
262 0.49
263 0.54
264 0.58
265 0.58
266 0.59
267 0.62
268 0.57
269 0.51
270 0.48
271 0.49
272 0.47
273 0.43
274 0.39
275 0.36
276 0.37
277 0.4
278 0.41
279 0.4
280 0.4
281 0.39
282 0.37
283 0.34
284 0.29
285 0.29
286 0.28
287 0.27
288 0.24
289 0.24
290 0.22
291 0.21
292 0.21
293 0.17
294 0.15
295 0.1
296 0.09
297 0.07
298 0.07
299 0.08
300 0.07
301 0.08
302 0.08
303 0.1
304 0.11
305 0.12
306 0.16
307 0.23
308 0.29
309 0.31
310 0.38
311 0.45
312 0.54
313 0.62
314 0.69
315 0.72
316 0.78
317 0.86
318 0.88
319 0.91
320 0.89
321 0.88
322 0.85
323 0.82
324 0.79
325 0.77
326 0.75
327 0.68
328 0.63
329 0.59
330 0.53
331 0.46
332 0.44
333 0.42
334 0.44
335 0.5
336 0.55
337 0.57
338 0.64
339 0.71
340 0.74
341 0.77
342 0.78
343 0.77
344 0.79
345 0.81
346 0.83
347 0.85
348 0.87
349 0.88
350 0.88
351 0.87
352 0.88
353 0.9
354 0.88
355 0.85
356 0.81
357 0.73
358 0.69
359 0.67
360 0.65
361 0.63
362 0.61
363 0.61
364 0.63
365 0.7
366 0.69
367 0.67
368 0.67
369 0.66
370 0.63
371 0.6
372 0.52
373 0.47
374 0.52
375 0.47
376 0.39
377 0.4
378 0.38
379 0.36
380 0.44
381 0.4
382 0.33
383 0.4
384 0.48
385 0.5
386 0.58
387 0.6
388 0.55
389 0.56
390 0.59
391 0.56
392 0.5
393 0.44
394 0.37
395 0.41
396 0.45
397 0.45
398 0.44
399 0.44
400 0.51
401 0.57
402 0.6
403 0.59
404 0.58
405 0.66
406 0.72
407 0.72
408 0.73
409 0.72
410 0.74
411 0.72
412 0.76
413 0.76
414 0.77
415 0.78
416 0.74
417 0.76
418 0.71
419 0.69
420 0.67
421 0.63
422 0.6
423 0.61
424 0.64
425 0.57
426 0.58
427 0.62