Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2A9NQI8

Protein Details
Accession A0A2A9NQI8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
50-70RYIRCHAVKEEKRTAKKKSRVBasic
NLS Segment(s)
PositionSequence
61-69KRTAKKKSR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRSNMQSQPQPQPQQSSHTTTQGSRSILGTGIGSFLINSPSRRQPFIALRYIRCHAVKEEKRTAKKKSRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.51
4 0.44
5 0.42
6 0.41
7 0.35
8 0.38
9 0.35
10 0.32
11 0.26
12 0.23
13 0.19
14 0.18
15 0.17
16 0.12
17 0.08
18 0.07
19 0.06
20 0.05
21 0.05
22 0.05
23 0.07
24 0.08
25 0.09
26 0.12
27 0.2
28 0.22
29 0.24
30 0.25
31 0.29
32 0.35
33 0.39
34 0.44
35 0.41
36 0.42
37 0.46
38 0.47
39 0.45
40 0.39
41 0.36
42 0.33
43 0.4
44 0.44
45 0.48
46 0.57
47 0.62
48 0.71
49 0.76
50 0.81