Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3B5L2

Protein Details
Accession A0A2T3B5L2    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-24NSSLHSSRRKSRKAHFSAPSHydrophilic
NLS Segment(s)
PositionSequence
123-132KAGREIKAKK
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005825  Ribosomal_L24/26_CS  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00467  KOW  
PF16906  Ribosomal_L26  
PROSITE View protein in PROSITE  
PS01108  RIBOSOMAL_L24  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MTKINSSLHSSRRKSRKAHFSAPSSVRRTIMSAPLSKELREKYNVRSIPIRKDDEVTIVRGSNKGREGKVTSVYRLKYVIHVERVVKEKSSGQSVPVGVHPSKVVITKLKLDKDRENILERIKAGREIKAKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.76
3 0.79
4 0.77
5 0.81
6 0.79
7 0.74
8 0.76
9 0.74
10 0.73
11 0.66
12 0.59
13 0.51
14 0.44
15 0.41
16 0.34
17 0.34
18 0.31
19 0.3
20 0.3
21 0.36
22 0.36
23 0.33
24 0.36
25 0.32
26 0.31
27 0.33
28 0.33
29 0.32
30 0.41
31 0.42
32 0.39
33 0.44
34 0.44
35 0.47
36 0.51
37 0.49
38 0.4
39 0.41
40 0.38
41 0.36
42 0.33
43 0.27
44 0.21
45 0.18
46 0.18
47 0.18
48 0.18
49 0.16
50 0.19
51 0.2
52 0.2
53 0.21
54 0.24
55 0.24
56 0.3
57 0.28
58 0.27
59 0.29
60 0.29
61 0.27
62 0.25
63 0.23
64 0.2
65 0.24
66 0.24
67 0.23
68 0.25
69 0.25
70 0.28
71 0.32
72 0.29
73 0.25
74 0.22
75 0.23
76 0.23
77 0.27
78 0.24
79 0.21
80 0.23
81 0.23
82 0.23
83 0.21
84 0.24
85 0.18
86 0.19
87 0.17
88 0.15
89 0.16
90 0.16
91 0.17
92 0.18
93 0.2
94 0.28
95 0.34
96 0.4
97 0.45
98 0.49
99 0.54
100 0.56
101 0.61
102 0.57
103 0.56
104 0.53
105 0.51
106 0.49
107 0.43
108 0.41
109 0.35
110 0.38
111 0.35
112 0.39
113 0.44