Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3B9H3

Protein Details
Accession A0A2T3B9H3    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
65-85CMDAPKPKTQKKNTINYHLSRHydrophilic
NLS Segment(s)
PositionSequence
95-97KRK
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MPAKGAPTKLQPMRLPPLHKLRVRRPNQADANPCVSIMSSVLSCWASAGFNVAGCQAVEAQLRACMDAPKPKTQKKNTINYHLSRMYPNIVGPRKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.56
3 0.54
4 0.6
5 0.61
6 0.62
7 0.64
8 0.65
9 0.69
10 0.71
11 0.74
12 0.7
13 0.71
14 0.74
15 0.73
16 0.68
17 0.61
18 0.59
19 0.49
20 0.43
21 0.33
22 0.25
23 0.18
24 0.13
25 0.1
26 0.05
27 0.05
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.05
34 0.05
35 0.07
36 0.05
37 0.05
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.04
44 0.06
45 0.06
46 0.06
47 0.06
48 0.08
49 0.08
50 0.09
51 0.09
52 0.1
53 0.12
54 0.2
55 0.24
56 0.32
57 0.39
58 0.47
59 0.56
60 0.63
61 0.71
62 0.72
63 0.79
64 0.77
65 0.8
66 0.81
67 0.74
68 0.73
69 0.66
70 0.59
71 0.51
72 0.45
73 0.38
74 0.32
75 0.31
76 0.34
77 0.38