Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3BA69

Protein Details
Accession A0A2T3BA69    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-34AQTPEQRKRNQKFAKEQTAKHydrophilic
NLS Segment(s)
PositionSequence
22-45KRNQKFAKEQTAKRGKPASEIKKK
Subcellular Location(s) mito_nucl 7.666, nucl 7.5, mito 7.5, cyto_nucl 6.333, cyto_mito 6.333, plas 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MFWPSIGHIASQNIAQTPEQRKRNQKFAKEQTAKRGKPASEIKKKQEFKSPISPVALALLGFVVFGGLLFELLSRIFFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.2
4 0.27
5 0.35
6 0.41
7 0.48
8 0.57
9 0.61
10 0.71
11 0.73
12 0.73
13 0.75
14 0.77
15 0.81
16 0.79
17 0.75
18 0.75
19 0.77
20 0.68
21 0.63
22 0.59
23 0.48
24 0.47
25 0.54
26 0.53
27 0.54
28 0.59
29 0.61
30 0.66
31 0.7
32 0.65
33 0.65
34 0.6
35 0.55
36 0.6
37 0.56
38 0.49
39 0.47
40 0.45
41 0.35
42 0.31
43 0.25
44 0.15
45 0.11
46 0.08
47 0.06
48 0.05
49 0.05
50 0.03
51 0.02
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.04
59 0.05