Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AW88

Protein Details
Accession A0A2T3AW88   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MVSAKKHVPIVKKRTKRFNRHQSDTFKCVDPSWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
13-13K
Subcellular Location(s) mito 14.5, mito_nucl 11.833, nucl 8, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKRFNRHQSDTFKCVDPSWRKPKGIDNRVRRRFKGTIAMPSIGYGSNKKTRHMMPSGHKAFLVNNVRDVDLLLMHNRTFAAEIAHAVSSRKRVEIIARAKELGVKVTNPKAKLTVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.89
4 0.9
5 0.9
6 0.9
7 0.88
8 0.88
9 0.86
10 0.83
11 0.77
12 0.69
13 0.6
14 0.5
15 0.43
16 0.44
17 0.43
18 0.46
19 0.51
20 0.55
21 0.54
22 0.55
23 0.64
24 0.65
25 0.67
26 0.67
27 0.68
28 0.72
29 0.8
30 0.84
31 0.76
32 0.73
33 0.65
34 0.58
35 0.57
36 0.49
37 0.47
38 0.44
39 0.43
40 0.35
41 0.33
42 0.3
43 0.21
44 0.19
45 0.12
46 0.13
47 0.2
48 0.21
49 0.21
50 0.25
51 0.26
52 0.31
53 0.33
54 0.35
55 0.34
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.31
62 0.33
63 0.34
64 0.24
65 0.24
66 0.25
67 0.25
68 0.24
69 0.24
70 0.16
71 0.1
72 0.1
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.08
81 0.09
82 0.08
83 0.09
84 0.1
85 0.11
86 0.11
87 0.11
88 0.13
89 0.16
90 0.17
91 0.17
92 0.17
93 0.18
94 0.24
95 0.32
96 0.39
97 0.41
98 0.42
99 0.42
100 0.41
101 0.43
102 0.38
103 0.33
104 0.27
105 0.23
106 0.27
107 0.36
108 0.41
109 0.39
110 0.41
111 0.4