Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7S913

Protein Details
Accession Q7S913    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-26RAGGKAKPLKAPKKDKKELDEBasic
NLS Segment(s)
PositionSequence
7-68AGGKAKPLKAPKKDKKELDEDDKAFLEKKRAEEKARKDLAAKAGGKGPLNTGAQGIKKSGKK
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
KEGG ncr:NCU07972  -  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MGGADRAGGKAKPLKAPKKDKKELDEDDKAFLEKKRAEEKARKDLAAKAGGKGPLNTGAQGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.58
3 0.69
4 0.75
5 0.79
6 0.84
7 0.82
8 0.79
9 0.78
10 0.75
11 0.72
12 0.7
13 0.6
14 0.53
15 0.47
16 0.41
17 0.34
18 0.27
19 0.24
20 0.19
21 0.22
22 0.26
23 0.31
24 0.36
25 0.43
26 0.49
27 0.54
28 0.55
29 0.51
30 0.47
31 0.46
32 0.46
33 0.45
34 0.39
35 0.3
36 0.31
37 0.33
38 0.32
39 0.29
40 0.25
41 0.23
42 0.23
43 0.22
44 0.2
45 0.21
46 0.23
47 0.24
48 0.25