Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3AZ67

Protein Details
Accession A0A2T3AZ67    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
37-60DLPTPPPRTKRQTGKEKEKKSLLLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13, nucl 12.5, cyto 12.5
Family & Domain DBs
Amino Acid Sequences MDGWMNGWVDGWIVHSLVGSKASKVEVRETDVFSSSDLPTPPPRTKRQTGKEKEKKSLLLMIIIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.08
4 0.09
5 0.13
6 0.11
7 0.1
8 0.11
9 0.13
10 0.15
11 0.16
12 0.2
13 0.18
14 0.23
15 0.25
16 0.25
17 0.24
18 0.23
19 0.22
20 0.17
21 0.18
22 0.13
23 0.13
24 0.12
25 0.13
26 0.17
27 0.23
28 0.29
29 0.33
30 0.4
31 0.46
32 0.55
33 0.63
34 0.68
35 0.73
36 0.77
37 0.83
38 0.86
39 0.86
40 0.85
41 0.81
42 0.74
43 0.67
44 0.63
45 0.53