Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3B9R6

Protein Details
Accession A0A2T3B9R6    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-32IPTSADPRSKRPLKKRAVNHTPAAHydrophilic
118-156REKREREERDREKTRKNREKRERLKLKKGKKGGKTEGESBasic
NLS Segment(s)
PositionSequence
18-23KRPLKK
112-151EEEKWEREKREREERDREKTRKNREKRERLKLKKGKKGGK
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSEPIPESIPTSADPRSKRPLKKRAVNHTPAAAQAASLEALFAKPDQEIRIPSPASSSAPSKNFSAPPEIVANVQGSSAGAGSGEFHVYKASRRREYERLRAMEEEVAKEREEEKWEREKREREERDREKTRKNREKRERLKLKKGKKGGKTEGESMEGIEKVGMKPRDDGGPRNDVQEEQDGTMKAVEEVGVIIHDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.44
4 0.52
5 0.6
6 0.67
7 0.73
8 0.76
9 0.82
10 0.86
11 0.87
12 0.88
13 0.85
14 0.78
15 0.73
16 0.63
17 0.54
18 0.47
19 0.35
20 0.24
21 0.18
22 0.15
23 0.1
24 0.08
25 0.07
26 0.05
27 0.05
28 0.06
29 0.06
30 0.06
31 0.06
32 0.08
33 0.1
34 0.13
35 0.16
36 0.18
37 0.24
38 0.24
39 0.23
40 0.24
41 0.23
42 0.22
43 0.21
44 0.22
45 0.22
46 0.24
47 0.26
48 0.25
49 0.27
50 0.28
51 0.27
52 0.29
53 0.24
54 0.23
55 0.23
56 0.22
57 0.19
58 0.17
59 0.16
60 0.11
61 0.1
62 0.08
63 0.06
64 0.06
65 0.05
66 0.04
67 0.03
68 0.03
69 0.04
70 0.04
71 0.05
72 0.05
73 0.05
74 0.06
75 0.07
76 0.12
77 0.19
78 0.26
79 0.3
80 0.34
81 0.4
82 0.49
83 0.56
84 0.61
85 0.61
86 0.56
87 0.52
88 0.49
89 0.44
90 0.37
91 0.31
92 0.23
93 0.18
94 0.17
95 0.15
96 0.15
97 0.14
98 0.13
99 0.17
100 0.18
101 0.21
102 0.3
103 0.35
104 0.4
105 0.47
106 0.53
107 0.55
108 0.64
109 0.67
110 0.65
111 0.72
112 0.74
113 0.76
114 0.79
115 0.78
116 0.77
117 0.78
118 0.81
119 0.8
120 0.82
121 0.83
122 0.85
123 0.9
124 0.9
125 0.92
126 0.92
127 0.9
128 0.92
129 0.9
130 0.89
131 0.87
132 0.87
133 0.85
134 0.82
135 0.83
136 0.81
137 0.8
138 0.75
139 0.71
140 0.63
141 0.57
142 0.48
143 0.39
144 0.32
145 0.23
146 0.18
147 0.13
148 0.12
149 0.1
150 0.18
151 0.2
152 0.19
153 0.21
154 0.23
155 0.31
156 0.33
157 0.37
158 0.35
159 0.41
160 0.4
161 0.41
162 0.4
163 0.33
164 0.33
165 0.33
166 0.3
167 0.24
168 0.27
169 0.24
170 0.24
171 0.24
172 0.21
173 0.15
174 0.13
175 0.11
176 0.08
177 0.07
178 0.07
179 0.06