Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3AZ06

Protein Details
Accession A0A2T3AZ06    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-32RELGRKASERRSSHRRCRVRCRCASNARLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 8, cyto 3
Family & Domain DBs
Amino Acid Sequences MRRRELGRKASERRSSHRRCRVRCRCASNARLEYCYIRWLIMHSSRIPALCDRCSDCLRACAGNCSRSARSLAQDSRTRGYQYRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.79
4 0.81
5 0.82
6 0.81
7 0.87
8 0.89
9 0.89
10 0.88
11 0.85
12 0.84
13 0.83
14 0.8
15 0.78
16 0.74
17 0.66
18 0.58
19 0.51
20 0.43
21 0.35
22 0.31
23 0.21
24 0.14
25 0.12
26 0.12
27 0.15
28 0.16
29 0.17
30 0.16
31 0.17
32 0.18
33 0.18
34 0.18
35 0.18
36 0.18
37 0.17
38 0.19
39 0.2
40 0.24
41 0.25
42 0.26
43 0.23
44 0.23
45 0.24
46 0.24
47 0.22
48 0.26
49 0.29
50 0.29
51 0.31
52 0.33
53 0.32
54 0.31
55 0.35
56 0.3
57 0.31
58 0.37
59 0.39
60 0.41
61 0.46
62 0.49
63 0.49
64 0.5
65 0.5