Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AW41

Protein Details
Accession A0A2T3AW41    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-66TTELSNTRRDSKKRKRNKDPNDDTPKAFHydrophilic
209-233VAGNGKKKGKKGKGKKKVRGEVDDGBasic
NLS Segment(s)
PositionSequence
47-56RDSKKRKRNK
87-96RESKAQKKRK
159-159R
213-227GKKKGKKGKGKKKVR
Subcellular Location(s) cyto_nucl 12.833, nucl 12.5, cyto 12, cyto_mito 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR038871  C607.02c-like  
Amino Acid Sequences MPHKHTRKGEDKSTVDLPPTVIAKPLPVSKSANANGIFTTELSNTRRDSKKRKRNKDPNDDTPKAFARLMAFQAGKKLPKGLDDGVRESKAQKKRKLAAEKDGEAQAPTETPAQQMPTIRVGESMSDFAVRVDAALPVSGLINKTARGGKDPLGLKVRRTKTEKRMHRMYDEWREQDRKIREKREEALELAEEEAMDEDGQVKWKVDIVAGNGKKKGKKGKGKKKVRGEVDDGEDDPWEQIKKNRAEAPISLNDVAQAPPTFSRLPKEKFKVRGARVDIEDVPKASGSLRRREELGEVRRSVVEGYRAMMKKNQGLAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.5
3 0.43
4 0.35
5 0.29
6 0.28
7 0.22
8 0.2
9 0.18
10 0.18
11 0.21
12 0.26
13 0.24
14 0.25
15 0.3
16 0.31
17 0.39
18 0.39
19 0.42
20 0.36
21 0.36
22 0.32
23 0.29
24 0.26
25 0.18
26 0.18
27 0.13
28 0.17
29 0.18
30 0.22
31 0.23
32 0.31
33 0.39
34 0.45
35 0.55
36 0.61
37 0.7
38 0.78
39 0.87
40 0.9
41 0.93
42 0.95
43 0.95
44 0.94
45 0.94
46 0.93
47 0.85
48 0.76
49 0.7
50 0.62
51 0.53
52 0.43
53 0.34
54 0.27
55 0.26
56 0.26
57 0.26
58 0.24
59 0.21
60 0.27
61 0.29
62 0.28
63 0.26
64 0.28
65 0.23
66 0.25
67 0.29
68 0.27
69 0.31
70 0.32
71 0.37
72 0.37
73 0.38
74 0.36
75 0.34
76 0.38
77 0.4
78 0.46
79 0.48
80 0.53
81 0.59
82 0.68
83 0.76
84 0.73
85 0.74
86 0.72
87 0.67
88 0.61
89 0.55
90 0.45
91 0.35
92 0.3
93 0.2
94 0.13
95 0.12
96 0.1
97 0.09
98 0.09
99 0.1
100 0.11
101 0.13
102 0.14
103 0.15
104 0.17
105 0.17
106 0.16
107 0.16
108 0.15
109 0.14
110 0.14
111 0.12
112 0.09
113 0.08
114 0.08
115 0.07
116 0.07
117 0.06
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.04
124 0.04
125 0.05
126 0.05
127 0.05
128 0.06
129 0.06
130 0.07
131 0.09
132 0.11
133 0.11
134 0.14
135 0.16
136 0.16
137 0.22
138 0.22
139 0.24
140 0.29
141 0.29
142 0.29
143 0.36
144 0.38
145 0.38
146 0.44
147 0.48
148 0.51
149 0.61
150 0.67
151 0.66
152 0.7
153 0.67
154 0.64
155 0.61
156 0.58
157 0.57
158 0.54
159 0.5
160 0.46
161 0.46
162 0.43
163 0.46
164 0.46
165 0.46
166 0.49
167 0.53
168 0.54
169 0.57
170 0.6
171 0.59
172 0.54
173 0.45
174 0.39
175 0.31
176 0.25
177 0.2
178 0.16
179 0.09
180 0.07
181 0.06
182 0.05
183 0.04
184 0.04
185 0.04
186 0.05
187 0.07
188 0.08
189 0.08
190 0.08
191 0.1
192 0.1
193 0.1
194 0.12
195 0.13
196 0.22
197 0.26
198 0.29
199 0.31
200 0.35
201 0.36
202 0.41
203 0.48
204 0.48
205 0.55
206 0.64
207 0.71
208 0.78
209 0.87
210 0.91
211 0.91
212 0.9
213 0.87
214 0.82
215 0.77
216 0.71
217 0.65
218 0.57
219 0.47
220 0.38
221 0.3
222 0.24
223 0.18
224 0.15
225 0.11
226 0.11
227 0.15
228 0.23
229 0.27
230 0.33
231 0.39
232 0.4
233 0.42
234 0.43
235 0.45
236 0.42
237 0.41
238 0.35
239 0.29
240 0.27
241 0.25
242 0.22
243 0.18
244 0.13
245 0.11
246 0.12
247 0.15
248 0.17
249 0.17
250 0.24
251 0.3
252 0.36
253 0.44
254 0.52
255 0.57
256 0.63
257 0.71
258 0.74
259 0.71
260 0.75
261 0.7
262 0.69
263 0.63
264 0.61
265 0.54
266 0.48
267 0.44
268 0.36
269 0.31
270 0.24
271 0.21
272 0.18
273 0.22
274 0.24
275 0.31
276 0.35
277 0.37
278 0.38
279 0.4
280 0.46
281 0.48
282 0.51
283 0.5
284 0.46
285 0.46
286 0.45
287 0.44
288 0.38
289 0.32
290 0.28
291 0.21
292 0.21
293 0.28
294 0.29
295 0.31
296 0.35
297 0.36
298 0.38