Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3BGA4

Protein Details
Accession A0A2T3BGA4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
311-330LHPKVEVKKAFERPRRPGRKBasic
NLS Segment(s)
PositionSequence
318-330KKAFERPRRPGRK
Subcellular Location(s) nucl 19, cyto_nucl 14.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002108  ADF-H  
IPR029006  ADF-H/Gelsolin-like_dom_sf  
IPR028458  Twinfilin  
Gene Ontology GO:0005856  C:cytoskeleton  
GO:0003779  F:actin binding  
GO:0030837  P:negative regulation of actin filament polymerization  
Pfam View protein in Pfam  
PF00241  Cofilin_ADF  
PROSITE View protein in PROSITE  
PS51263  ADF_H  
CDD cd11284  ADF_Twf-C_like  
cd11285  ADF_Twf-N_like  
Amino Acid Sequences MQSGISASEELHSAFKALVSSSNQRGLLCTITKESLTPLTVLEPATSSFDDDLSLLTPHLQPNVALYIILRRYPSDENAPFIAVTYVPDAAPVRQKMLFASTRLTLVRELGIERFRETIFATTTEELTKEGFEKHDRHVKLEAPLTEEEQSLGEVKRKEAEEGRGMGERKSHVASGGTQLPVSDEAVQALKGLAEGKDNLVQLKINIATETIELASSTSTPISSLASSISATEPRYTFYRYEHEYNGTSLSPLLFIYTCPSGSKIKERMLYASSRRSALQIAEEDARLKIEKKIEASSPEDISAESIDSDLHPKVEVKKAFERPRRPGRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.1
5 0.14
6 0.18
7 0.25
8 0.29
9 0.34
10 0.35
11 0.34
12 0.35
13 0.33
14 0.32
15 0.28
16 0.26
17 0.24
18 0.24
19 0.25
20 0.23
21 0.24
22 0.22
23 0.21
24 0.19
25 0.16
26 0.16
27 0.18
28 0.17
29 0.15
30 0.12
31 0.12
32 0.15
33 0.15
34 0.14
35 0.13
36 0.13
37 0.13
38 0.12
39 0.11
40 0.09
41 0.09
42 0.08
43 0.1
44 0.12
45 0.12
46 0.14
47 0.13
48 0.12
49 0.14
50 0.16
51 0.14
52 0.12
53 0.11
54 0.16
55 0.17
56 0.19
57 0.17
58 0.16
59 0.2
60 0.23
61 0.26
62 0.29
63 0.29
64 0.3
65 0.31
66 0.31
67 0.26
68 0.24
69 0.21
70 0.12
71 0.11
72 0.09
73 0.09
74 0.08
75 0.1
76 0.1
77 0.11
78 0.18
79 0.17
80 0.19
81 0.19
82 0.2
83 0.19
84 0.24
85 0.25
86 0.19
87 0.21
88 0.19
89 0.2
90 0.2
91 0.21
92 0.15
93 0.14
94 0.13
95 0.11
96 0.12
97 0.13
98 0.15
99 0.15
100 0.15
101 0.16
102 0.15
103 0.15
104 0.15
105 0.15
106 0.13
107 0.13
108 0.15
109 0.14
110 0.15
111 0.14
112 0.13
113 0.11
114 0.11
115 0.1
116 0.08
117 0.09
118 0.11
119 0.15
120 0.17
121 0.21
122 0.29
123 0.29
124 0.31
125 0.33
126 0.33
127 0.32
128 0.34
129 0.3
130 0.25
131 0.25
132 0.24
133 0.22
134 0.19
135 0.16
136 0.12
137 0.11
138 0.09
139 0.09
140 0.12
141 0.11
142 0.12
143 0.15
144 0.15
145 0.17
146 0.18
147 0.21
148 0.2
149 0.21
150 0.23
151 0.23
152 0.23
153 0.21
154 0.2
155 0.17
156 0.16
157 0.15
158 0.14
159 0.11
160 0.11
161 0.11
162 0.13
163 0.15
164 0.13
165 0.12
166 0.12
167 0.12
168 0.12
169 0.12
170 0.09
171 0.06
172 0.07
173 0.07
174 0.07
175 0.07
176 0.06
177 0.05
178 0.05
179 0.05
180 0.05
181 0.06
182 0.06
183 0.08
184 0.11
185 0.11
186 0.11
187 0.11
188 0.11
189 0.1
190 0.12
191 0.12
192 0.09
193 0.09
194 0.09
195 0.09
196 0.09
197 0.09
198 0.07
199 0.06
200 0.05
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.05
208 0.06
209 0.07
210 0.06
211 0.07
212 0.07
213 0.07
214 0.07
215 0.08
216 0.09
217 0.1
218 0.11
219 0.13
220 0.13
221 0.15
222 0.17
223 0.19
224 0.19
225 0.2
226 0.26
227 0.28
228 0.32
229 0.33
230 0.34
231 0.33
232 0.33
233 0.31
234 0.25
235 0.2
236 0.16
237 0.13
238 0.1
239 0.08
240 0.09
241 0.07
242 0.07
243 0.1
244 0.11
245 0.11
246 0.12
247 0.15
248 0.17
249 0.21
250 0.29
251 0.32
252 0.37
253 0.41
254 0.42
255 0.43
256 0.43
257 0.47
258 0.44
259 0.46
260 0.42
261 0.39
262 0.38
263 0.36
264 0.34
265 0.29
266 0.28
267 0.21
268 0.23
269 0.23
270 0.23
271 0.23
272 0.21
273 0.21
274 0.17
275 0.17
276 0.19
277 0.22
278 0.26
279 0.28
280 0.32
281 0.35
282 0.38
283 0.41
284 0.4
285 0.37
286 0.33
287 0.3
288 0.26
289 0.23
290 0.19
291 0.15
292 0.1
293 0.09
294 0.08
295 0.09
296 0.12
297 0.12
298 0.12
299 0.13
300 0.16
301 0.22
302 0.3
303 0.34
304 0.37
305 0.46
306 0.56
307 0.65
308 0.72
309 0.76
310 0.77