Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7S2D5

Protein Details
Accession Q7S2D5   
Localization Confidence High
Confidence Score 19.6
NoLS Segment(s)
PositionSequenceProtein Nature
23-47LDQIDIPKKRGKKAAKKAVPEPEEPHydrophilic
125-156RKAFEEEKAEKRRRGNKKKSKRVSDHKEESAQBasic
910-946HQPHPPPPQHHQQPQQQQQHPPKHQAQHPPQHQPQHQHydrophilic
959-980QPASHHPQPPQHQQHQPPQPQHHydrophilic
NLS Segment(s)
PositionSequence
29-40PKKRGKKAAKKA
121-197WEARRKAFEEEKAEKRRRGNKKKSKRVSDHKEESAQVSQKPKPSPVPEPKKDAKTAAGQKRKTTEPVPEKEPKQKVR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.833, mito_nucl 11.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR012921  SPOC_C  
IPR003618  TFIIS_cen_dom  
IPR036575  TFIIS_cen_dom_sf  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0001139  F:RNA polymerase II complex recruiting activity  
GO:0000977  F:RNA polymerase II transcription regulatory region sequence-specific DNA binding  
GO:0006351  P:DNA-templated transcription  
GO:0031440  P:regulation of mRNA 3'-end processing  
GO:0031564  P:transcription antitermination  
GO:0006362  P:transcription elongation by RNA polymerase I  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG ncr:NCU05943  -  
Pfam View protein in Pfam  
PF00628  PHD  
PF07744  SPOC  
PF07500  TFIIS_M  
PROSITE View protein in PROSITE  
PS51321  TFIIS_CENTRAL  
PS01359  ZF_PHD_1  
CDD cd21538  SPOC_TFIIS  
Amino Acid Sequences MSEPEPRRSVRATKGQHKALEQLDQIDIPKKRGKKAAKKAVPEPEEPEEEIIRCVCGATEQDEDSGEPWIACDMCGAWQHNICMGMSQYSEDLPKEYFCELCKPENHQELLNGMKNGERPWEARRKAFEEEKAEKRRRGNKKKSKRVSDHKEESAQVSQKPKPSPVPEPKKDAKTAAGQKRKTTEPVPEKEPKQKVRKVTETQAPSLPSYKAPDDIAGKISELPELRQGAAKLLSKSLVHSIGVAEKKGVSIPSEGVSASAERLAIQIERAVHDSHQPTAYSGQMRTLSYNLKTNQDLTTGLLGGTLTPTMLASMTTEELATKELQKETAEMKARAEKQSIMITEDVPRIRKTHKGEEVIGDESFNLSTDVSSAPVRRPPQDTAEPPKKRVKEEGPERAAQGTASKRASRDLTVDTQKSPSTGNFDINKVFSSVRSPTQSHHRRPSAMSTSTGPGVDADVDRLLDDGTQSPPYSPKEEILDPDVVWKGNLVMNTIADFQVTAKHIGGAKLKESIGLEWDKLMPKTLTVCGRIDEQQAIVYLCSLRYSLPTDVVVVNLQPTSAASKPQFQRLVDYFVSKKRYGVIGDRGVANVRDTYLVPVLPGTGQYPEFMLNLADNHIPETRTEPMLLAVFVYRNDPDTIMRLHGTNDYNQVVANQSTKVHTSFANTPAPSSPALANLPPGHRPSLSTPAFSPTSPQGTFPNYPTPRHSSTPSQVPPQQQPQPTPPAQQHSVSQIQHPAVDQVQKQGEAIAREVLGSLITSPTVAFLLPQAHKMSRKEWEVIKKIYERDPKARDDLPYLSNVLERESTNAQAKAAQAQQQSQQHPVHQQHQNQQQQMHHQPHHQQHHPQHQVQQQQQQQQQQHLPQHPPQHQPHHQAHFQPQPQHQQQHQAHHPPHHQPQHQSQQQAHHQPHPPPPQHHQQPQQQQQHPPKHQAQHPPQHQPQHQAPAQQPQAAYPPQPASHHPQPPQHQQHQPPQPQHAQPHPQAQPQQAHPQHHQQYFTPPVRTTPIPPPPIPPVTSGSGGPIKQTPIPPPPIPHQAATAATGPPSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.74
4 0.69
5 0.67
6 0.6
7 0.58
8 0.49
9 0.43
10 0.37
11 0.34
12 0.33
13 0.34
14 0.33
15 0.32
16 0.37
17 0.4
18 0.46
19 0.54
20 0.63
21 0.66
22 0.75
23 0.81
24 0.82
25 0.84
26 0.86
27 0.87
28 0.81
29 0.73
30 0.69
31 0.63
32 0.58
33 0.51
34 0.45
35 0.37
36 0.33
37 0.31
38 0.25
39 0.19
40 0.15
41 0.14
42 0.11
43 0.11
44 0.12
45 0.14
46 0.17
47 0.18
48 0.19
49 0.19
50 0.2
51 0.18
52 0.18
53 0.14
54 0.1
55 0.1
56 0.12
57 0.11
58 0.1
59 0.1
60 0.09
61 0.12
62 0.17
63 0.2
64 0.22
65 0.24
66 0.25
67 0.27
68 0.28
69 0.24
70 0.21
71 0.19
72 0.17
73 0.15
74 0.15
75 0.14
76 0.14
77 0.16
78 0.15
79 0.16
80 0.15
81 0.15
82 0.17
83 0.17
84 0.18
85 0.18
86 0.26
87 0.28
88 0.33
89 0.37
90 0.42
91 0.49
92 0.55
93 0.55
94 0.48
95 0.46
96 0.43
97 0.45
98 0.42
99 0.34
100 0.26
101 0.27
102 0.28
103 0.27
104 0.28
105 0.25
106 0.23
107 0.31
108 0.41
109 0.43
110 0.48
111 0.53
112 0.53
113 0.58
114 0.62
115 0.61
116 0.6
117 0.63
118 0.67
119 0.7
120 0.73
121 0.71
122 0.73
123 0.76
124 0.78
125 0.81
126 0.83
127 0.84
128 0.88
129 0.93
130 0.95
131 0.96
132 0.95
133 0.95
134 0.94
135 0.93
136 0.9
137 0.86
138 0.8
139 0.71
140 0.64
141 0.6
142 0.54
143 0.47
144 0.46
145 0.44
146 0.45
147 0.47
148 0.48
149 0.49
150 0.51
151 0.57
152 0.61
153 0.68
154 0.67
155 0.72
156 0.75
157 0.73
158 0.7
159 0.63
160 0.56
161 0.55
162 0.59
163 0.61
164 0.63
165 0.6
166 0.62
167 0.64
168 0.64
169 0.59
170 0.53
171 0.53
172 0.53
173 0.55
174 0.57
175 0.61
176 0.62
177 0.67
178 0.72
179 0.71
180 0.71
181 0.72
182 0.74
183 0.75
184 0.79
185 0.76
186 0.75
187 0.74
188 0.69
189 0.66
190 0.6
191 0.53
192 0.45
193 0.41
194 0.34
195 0.27
196 0.27
197 0.25
198 0.23
199 0.22
200 0.24
201 0.24
202 0.25
203 0.24
204 0.2
205 0.19
206 0.19
207 0.18
208 0.18
209 0.15
210 0.15
211 0.18
212 0.19
213 0.19
214 0.2
215 0.2
216 0.2
217 0.24
218 0.27
219 0.23
220 0.23
221 0.24
222 0.21
223 0.23
224 0.24
225 0.21
226 0.17
227 0.16
228 0.16
229 0.2
230 0.21
231 0.2
232 0.17
233 0.15
234 0.15
235 0.16
236 0.16
237 0.11
238 0.11
239 0.12
240 0.13
241 0.13
242 0.13
243 0.12
244 0.12
245 0.1
246 0.09
247 0.08
248 0.07
249 0.07
250 0.07
251 0.08
252 0.07
253 0.07
254 0.09
255 0.09
256 0.11
257 0.13
258 0.14
259 0.13
260 0.19
261 0.2
262 0.21
263 0.22
264 0.2
265 0.2
266 0.2
267 0.23
268 0.2
269 0.19
270 0.21
271 0.21
272 0.22
273 0.22
274 0.23
275 0.24
276 0.23
277 0.29
278 0.27
279 0.28
280 0.29
281 0.29
282 0.27
283 0.25
284 0.23
285 0.18
286 0.17
287 0.14
288 0.12
289 0.11
290 0.09
291 0.08
292 0.08
293 0.06
294 0.04
295 0.04
296 0.04
297 0.04
298 0.04
299 0.04
300 0.04
301 0.06
302 0.06
303 0.07
304 0.07
305 0.07
306 0.07
307 0.08
308 0.09
309 0.1
310 0.12
311 0.13
312 0.14
313 0.15
314 0.16
315 0.17
316 0.23
317 0.25
318 0.23
319 0.25
320 0.31
321 0.35
322 0.35
323 0.35
324 0.29
325 0.27
326 0.31
327 0.29
328 0.23
329 0.2
330 0.18
331 0.2
332 0.23
333 0.22
334 0.2
335 0.2
336 0.21
337 0.22
338 0.29
339 0.32
340 0.38
341 0.44
342 0.46
343 0.47
344 0.48
345 0.48
346 0.43
347 0.36
348 0.26
349 0.19
350 0.15
351 0.13
352 0.1
353 0.07
354 0.05
355 0.05
356 0.06
357 0.06
358 0.07
359 0.09
360 0.1
361 0.11
362 0.17
363 0.2
364 0.22
365 0.26
366 0.27
367 0.32
368 0.38
369 0.42
370 0.46
371 0.55
372 0.55
373 0.56
374 0.61
375 0.58
376 0.53
377 0.55
378 0.53
379 0.53
380 0.59
381 0.64
382 0.61
383 0.59
384 0.57
385 0.49
386 0.41
387 0.31
388 0.26
389 0.19
390 0.19
391 0.21
392 0.21
393 0.21
394 0.24
395 0.26
396 0.23
397 0.23
398 0.22
399 0.26
400 0.3
401 0.31
402 0.29
403 0.29
404 0.28
405 0.25
406 0.23
407 0.17
408 0.18
409 0.18
410 0.22
411 0.22
412 0.24
413 0.24
414 0.24
415 0.23
416 0.18
417 0.17
418 0.12
419 0.13
420 0.14
421 0.17
422 0.2
423 0.2
424 0.21
425 0.32
426 0.41
427 0.45
428 0.52
429 0.51
430 0.5
431 0.51
432 0.56
433 0.52
434 0.44
435 0.38
436 0.31
437 0.29
438 0.28
439 0.26
440 0.18
441 0.11
442 0.1
443 0.09
444 0.07
445 0.06
446 0.06
447 0.06
448 0.06
449 0.06
450 0.05
451 0.04
452 0.05
453 0.05
454 0.07
455 0.08
456 0.08
457 0.09
458 0.12
459 0.14
460 0.16
461 0.16
462 0.16
463 0.18
464 0.19
465 0.2
466 0.2
467 0.19
468 0.16
469 0.17
470 0.16
471 0.13
472 0.12
473 0.1
474 0.08
475 0.09
476 0.09
477 0.08
478 0.07
479 0.08
480 0.09
481 0.09
482 0.08
483 0.07
484 0.06
485 0.05
486 0.08
487 0.09
488 0.09
489 0.08
490 0.1
491 0.11
492 0.14
493 0.17
494 0.15
495 0.15
496 0.16
497 0.16
498 0.16
499 0.15
500 0.13
501 0.12
502 0.12
503 0.12
504 0.1
505 0.11
506 0.12
507 0.11
508 0.13
509 0.1
510 0.09
511 0.11
512 0.14
513 0.15
514 0.16
515 0.17
516 0.16
517 0.18
518 0.19
519 0.19
520 0.16
521 0.13
522 0.11
523 0.11
524 0.11
525 0.08
526 0.07
527 0.06
528 0.06
529 0.06
530 0.05
531 0.05
532 0.06
533 0.1
534 0.1
535 0.11
536 0.11
537 0.12
538 0.12
539 0.12
540 0.11
541 0.07
542 0.07
543 0.06
544 0.06
545 0.04
546 0.04
547 0.07
548 0.07
549 0.11
550 0.11
551 0.18
552 0.2
553 0.27
554 0.3
555 0.27
556 0.32
557 0.3
558 0.35
559 0.29
560 0.3
561 0.26
562 0.27
563 0.32
564 0.27
565 0.26
566 0.22
567 0.24
568 0.23
569 0.25
570 0.27
571 0.26
572 0.27
573 0.26
574 0.25
575 0.23
576 0.22
577 0.17
578 0.11
579 0.08
580 0.08
581 0.08
582 0.09
583 0.09
584 0.09
585 0.08
586 0.08
587 0.07
588 0.06
589 0.07
590 0.06
591 0.06
592 0.07
593 0.07
594 0.07
595 0.08
596 0.08
597 0.08
598 0.07
599 0.06
600 0.06
601 0.08
602 0.08
603 0.07
604 0.09
605 0.1
606 0.1
607 0.1
608 0.13
609 0.13
610 0.13
611 0.14
612 0.12
613 0.12
614 0.12
615 0.12
616 0.09
617 0.07
618 0.07
619 0.07
620 0.08
621 0.07
622 0.08
623 0.09
624 0.1
625 0.1
626 0.11
627 0.12
628 0.12
629 0.13
630 0.12
631 0.12
632 0.16
633 0.17
634 0.16
635 0.19
636 0.18
637 0.17
638 0.17
639 0.16
640 0.13
641 0.13
642 0.12
643 0.1
644 0.1
645 0.11
646 0.13
647 0.13
648 0.13
649 0.12
650 0.15
651 0.18
652 0.22
653 0.27
654 0.25
655 0.25
656 0.25
657 0.26
658 0.22
659 0.19
660 0.15
661 0.12
662 0.14
663 0.13
664 0.15
665 0.16
666 0.18
667 0.19
668 0.2
669 0.19
670 0.18
671 0.2
672 0.22
673 0.29
674 0.28
675 0.27
676 0.26
677 0.28
678 0.29
679 0.27
680 0.25
681 0.19
682 0.23
683 0.22
684 0.23
685 0.21
686 0.25
687 0.27
688 0.27
689 0.35
690 0.32
691 0.34
692 0.37
693 0.41
694 0.4
695 0.41
696 0.43
697 0.39
698 0.42
699 0.49
700 0.48
701 0.47
702 0.47
703 0.49
704 0.5
705 0.51
706 0.54
707 0.47
708 0.48
709 0.47
710 0.5
711 0.48
712 0.46
713 0.42
714 0.42
715 0.41
716 0.39
717 0.36
718 0.33
719 0.38
720 0.34
721 0.32
722 0.3
723 0.28
724 0.27
725 0.25
726 0.21
727 0.17
728 0.21
729 0.19
730 0.2
731 0.22
732 0.21
733 0.21
734 0.21
735 0.21
736 0.18
737 0.18
738 0.14
739 0.12
740 0.12
741 0.12
742 0.1
743 0.07
744 0.06
745 0.06
746 0.05
747 0.04
748 0.05
749 0.04
750 0.05
751 0.05
752 0.05
753 0.05
754 0.06
755 0.13
756 0.13
757 0.16
758 0.19
759 0.22
760 0.27
761 0.3
762 0.32
763 0.33
764 0.36
765 0.37
766 0.42
767 0.48
768 0.5
769 0.5
770 0.52
771 0.5
772 0.5
773 0.54
774 0.57
775 0.53
776 0.56
777 0.57
778 0.56
779 0.56
780 0.56
781 0.49
782 0.44
783 0.42
784 0.35
785 0.32
786 0.29
787 0.24
788 0.23
789 0.2
790 0.17
791 0.15
792 0.14
793 0.16
794 0.17
795 0.2
796 0.23
797 0.23
798 0.22
799 0.22
800 0.22
801 0.23
802 0.25
803 0.27
804 0.24
805 0.26
806 0.33
807 0.38
808 0.39
809 0.41
810 0.4
811 0.37
812 0.44
813 0.47
814 0.49
815 0.49
816 0.53
817 0.56
818 0.64
819 0.68
820 0.63
821 0.63
822 0.57
823 0.59
824 0.61
825 0.61
826 0.54
827 0.53
828 0.57
829 0.62
830 0.67
831 0.65
832 0.65
833 0.65
834 0.73
835 0.75
836 0.7
837 0.69
838 0.66
839 0.69
840 0.67
841 0.67
842 0.62
843 0.63
844 0.65
845 0.64
846 0.62
847 0.6
848 0.6
849 0.58
850 0.6
851 0.58
852 0.58
853 0.56
854 0.62
855 0.62
856 0.64
857 0.65
858 0.67
859 0.68
860 0.7
861 0.73
862 0.71
863 0.69
864 0.65
865 0.66
866 0.65
867 0.63
868 0.62
869 0.59
870 0.62
871 0.65
872 0.67
873 0.62
874 0.63
875 0.63
876 0.65
877 0.68
878 0.67
879 0.64
880 0.65
881 0.69
882 0.67
883 0.71
884 0.71
885 0.68
886 0.65
887 0.7
888 0.73
889 0.71
890 0.69
891 0.63
892 0.63
893 0.66
894 0.69
895 0.63
896 0.6
897 0.62
898 0.63
899 0.68
900 0.7
901 0.68
902 0.65
903 0.67
904 0.7
905 0.73
906 0.76
907 0.76
908 0.75
909 0.78
910 0.82
911 0.86
912 0.82
913 0.82
914 0.83
915 0.84
916 0.81
917 0.79
918 0.78
919 0.76
920 0.76
921 0.77
922 0.78
923 0.78
924 0.8
925 0.81
926 0.8
927 0.81
928 0.78
929 0.75
930 0.72
931 0.7
932 0.64
933 0.61
934 0.57
935 0.57
936 0.57
937 0.52
938 0.45
939 0.37
940 0.41
941 0.37
942 0.35
943 0.3
944 0.31
945 0.31
946 0.34
947 0.36
948 0.39
949 0.46
950 0.52
951 0.54
952 0.58
953 0.63
954 0.71
955 0.77
956 0.76
957 0.76
958 0.76
959 0.8
960 0.82
961 0.83
962 0.78
963 0.76
964 0.76
965 0.74
966 0.73
967 0.72
968 0.71
969 0.67
970 0.71
971 0.68
972 0.67
973 0.66
974 0.66
975 0.63
976 0.6
977 0.65
978 0.62
979 0.63
980 0.61
981 0.65
982 0.67
983 0.64
984 0.62
985 0.53
986 0.56
987 0.59
988 0.6
989 0.54
990 0.46
991 0.45
992 0.48
993 0.48
994 0.45
995 0.45
996 0.49
997 0.51
998 0.51
999 0.53
1000 0.55
1001 0.57
1002 0.53
1003 0.46
1004 0.41
1005 0.38
1006 0.39
1007 0.34
1008 0.31
1009 0.32
1010 0.3
1011 0.3
1012 0.28
1013 0.28
1014 0.31
1015 0.35
1016 0.36
1017 0.39
1018 0.46
1019 0.47
1020 0.5
1021 0.54
1022 0.58
1023 0.58
1024 0.52
1025 0.47
1026 0.44
1027 0.41
1028 0.38
1029 0.34
1030 0.25