Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3B1T4

Protein Details
Accession A0A2T3B1T4    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-41ARKSNISVKTRKNANKKRSDVNKKQSASHydrophilic
NLS Segment(s)
PositionSequence
22-32KTRKNANKKRS
Subcellular Location(s) nucl 19.5, mito_nucl 13.833, cyto_nucl 11.166, mito 6
Family & Domain DBs
Amino Acid Sequences MHFCNANKKQNVSARKSNISVKTRKNANKKRSDVNKKQSASVKKTGIATNGESERPHFMNSTQSTQGDAANAENKPRPDRILPWPEFEAEQAHTWGILMESSFVRERHFTSQRTSLSMGDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.65
3 0.66
4 0.65
5 0.66
6 0.64
7 0.65
8 0.63
9 0.64
10 0.68
11 0.73
12 0.77
13 0.78
14 0.8
15 0.82
16 0.8
17 0.82
18 0.83
19 0.85
20 0.84
21 0.84
22 0.83
23 0.74
24 0.74
25 0.72
26 0.7
27 0.65
28 0.61
29 0.53
30 0.46
31 0.48
32 0.44
33 0.38
34 0.32
35 0.27
36 0.24
37 0.23
38 0.21
39 0.18
40 0.18
41 0.19
42 0.17
43 0.16
44 0.13
45 0.12
46 0.19
47 0.21
48 0.23
49 0.22
50 0.21
51 0.21
52 0.21
53 0.21
54 0.14
55 0.12
56 0.09
57 0.11
58 0.11
59 0.12
60 0.15
61 0.16
62 0.18
63 0.2
64 0.22
65 0.21
66 0.26
67 0.33
68 0.41
69 0.41
70 0.43
71 0.43
72 0.4
73 0.38
74 0.34
75 0.26
76 0.18
77 0.18
78 0.14
79 0.13
80 0.12
81 0.11
82 0.11
83 0.08
84 0.06
85 0.05
86 0.06
87 0.07
88 0.1
89 0.13
90 0.13
91 0.15
92 0.17
93 0.21
94 0.29
95 0.35
96 0.35
97 0.39
98 0.47
99 0.46
100 0.49
101 0.47