Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ARR7

Protein Details
Accession A0A2T3ARR7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
94-114STWPEYKSRLWNKQPPPEQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, plas 6, mito 4, golg 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSWGRTPKAPPPPRSALSKLVPLIVLFVTLFVFAFIGYHLYRSFQKISAAANDKMQSKNVVFTKDGVKVGVKDVNTESYVDSTQGFLVKAWNLSTWPEYKSRLWNKQPPPEQGKAEARKPYTRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.63
3 0.59
4 0.54
5 0.54
6 0.46
7 0.39
8 0.36
9 0.29
10 0.26
11 0.18
12 0.15
13 0.09
14 0.08
15 0.07
16 0.06
17 0.06
18 0.05
19 0.05
20 0.04
21 0.04
22 0.04
23 0.06
24 0.06
25 0.08
26 0.08
27 0.1
28 0.12
29 0.15
30 0.17
31 0.15
32 0.17
33 0.17
34 0.19
35 0.23
36 0.27
37 0.24
38 0.25
39 0.26
40 0.27
41 0.26
42 0.25
43 0.21
44 0.16
45 0.21
46 0.2
47 0.2
48 0.18
49 0.19
50 0.22
51 0.22
52 0.22
53 0.17
54 0.16
55 0.14
56 0.16
57 0.17
58 0.14
59 0.13
60 0.13
61 0.15
62 0.15
63 0.15
64 0.13
65 0.12
66 0.12
67 0.11
68 0.1
69 0.09
70 0.09
71 0.09
72 0.09
73 0.07
74 0.09
75 0.1
76 0.11
77 0.11
78 0.11
79 0.1
80 0.12
81 0.15
82 0.16
83 0.17
84 0.19
85 0.23
86 0.26
87 0.35
88 0.43
89 0.5
90 0.57
91 0.65
92 0.71
93 0.77
94 0.81
95 0.81
96 0.79
97 0.75
98 0.69
99 0.68
100 0.69
101 0.66
102 0.65
103 0.64
104 0.61
105 0.63