Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AQJ9

Protein Details
Accession A0A2T3AQJ9   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
54-75STKSHDRRKKTSELTLRQRSQSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 8, mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR015915  Kelch-typ_b-propeller  
IPR006652  Kelch_1  
Pfam View protein in Pfam  
PF01344  Kelch_1  
PF13964  Kelch_6  
Amino Acid Sequences SDRDKTSRSAAKAKNVRSQQIMRVSPSDTRPQDIPEDSEPPKDVPRSHTPGHLSTKSHDRRKKTSELTLRQRSQSMSHKDSSTSSPKSSKPPSTHSNGNATPRPDSASSASRAPAPAASASSLNINNPTAARPLNLRSTSAIAPKPSQGSPSPAISRNTTPSQRGPAQHRSYIAFPPLPCPKTAPDVPLAPASGMYWSLAPVSGTAPVSLRAHTTTLIGSSIYIFGGCSSLSCFNELYVLDADSFYFSVPHVCGDIPVPLRAMTCTAVGKKLIVFGGGDGPAYYNDVYVLDTVNFRWSKPHVQGDGRNGDRYPSKRRAHTACLYRNGIYIFGGGDGVRALNDVWRLDVADTNKMSWKLISPPSTPSSEDRTVPKARGYHTANMVGSKLIIYGGSDGGECFRDVWIFDVATSLFTPVSIPPSASFPRLSHTATIVGSYLFVIGGHDGVEYCNEVLLLNLVTMVWDRRLVYGAKMKARGYHGAVLHDSRLVVVGGFDGATVFGDVWILELAVHAYYSQISHFSIDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.71
3 0.71
4 0.69
5 0.68
6 0.65
7 0.66
8 0.63
9 0.57
10 0.53
11 0.5
12 0.48
13 0.48
14 0.49
15 0.42
16 0.42
17 0.39
18 0.4
19 0.43
20 0.4
21 0.4
22 0.35
23 0.4
24 0.37
25 0.4
26 0.39
27 0.35
28 0.38
29 0.37
30 0.36
31 0.37
32 0.45
33 0.48
34 0.48
35 0.53
36 0.52
37 0.55
38 0.6
39 0.58
40 0.5
41 0.48
42 0.57
43 0.59
44 0.65
45 0.64
46 0.64
47 0.68
48 0.73
49 0.79
50 0.75
51 0.76
52 0.77
53 0.8
54 0.82
55 0.83
56 0.81
57 0.74
58 0.7
59 0.61
60 0.57
61 0.57
62 0.55
63 0.5
64 0.49
65 0.48
66 0.46
67 0.47
68 0.47
69 0.46
70 0.41
71 0.41
72 0.42
73 0.44
74 0.52
75 0.57
76 0.59
77 0.56
78 0.59
79 0.61
80 0.62
81 0.66
82 0.61
83 0.61
84 0.57
85 0.59
86 0.56
87 0.51
88 0.47
89 0.4
90 0.39
91 0.32
92 0.3
93 0.27
94 0.27
95 0.27
96 0.27
97 0.27
98 0.25
99 0.25
100 0.22
101 0.19
102 0.16
103 0.14
104 0.13
105 0.14
106 0.12
107 0.12
108 0.15
109 0.15
110 0.14
111 0.15
112 0.14
113 0.14
114 0.14
115 0.15
116 0.14
117 0.14
118 0.14
119 0.15
120 0.19
121 0.26
122 0.26
123 0.26
124 0.25
125 0.28
126 0.3
127 0.32
128 0.31
129 0.26
130 0.26
131 0.28
132 0.3
133 0.26
134 0.27
135 0.23
136 0.27
137 0.27
138 0.3
139 0.32
140 0.33
141 0.35
142 0.34
143 0.35
144 0.35
145 0.38
146 0.36
147 0.36
148 0.35
149 0.39
150 0.41
151 0.44
152 0.46
153 0.5
154 0.51
155 0.5
156 0.49
157 0.45
158 0.43
159 0.4
160 0.36
161 0.29
162 0.25
163 0.28
164 0.34
165 0.32
166 0.29
167 0.29
168 0.28
169 0.31
170 0.32
171 0.29
172 0.24
173 0.25
174 0.26
175 0.25
176 0.23
177 0.16
178 0.15
179 0.12
180 0.09
181 0.08
182 0.07
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.06
190 0.07
191 0.07
192 0.08
193 0.08
194 0.1
195 0.11
196 0.11
197 0.11
198 0.1
199 0.11
200 0.11
201 0.11
202 0.09
203 0.09
204 0.09
205 0.08
206 0.06
207 0.06
208 0.06
209 0.05
210 0.05
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.06
217 0.09
218 0.09
219 0.1
220 0.1
221 0.1
222 0.12
223 0.11
224 0.11
225 0.09
226 0.09
227 0.08
228 0.08
229 0.08
230 0.07
231 0.07
232 0.05
233 0.05
234 0.04
235 0.05
236 0.06
237 0.06
238 0.06
239 0.06
240 0.07
241 0.07
242 0.11
243 0.1
244 0.11
245 0.11
246 0.1
247 0.1
248 0.1
249 0.11
250 0.08
251 0.08
252 0.1
253 0.1
254 0.11
255 0.11
256 0.11
257 0.1
258 0.11
259 0.09
260 0.08
261 0.07
262 0.06
263 0.08
264 0.08
265 0.08
266 0.06
267 0.06
268 0.06
269 0.07
270 0.07
271 0.05
272 0.05
273 0.05
274 0.06
275 0.06
276 0.06
277 0.05
278 0.06
279 0.06
280 0.12
281 0.12
282 0.12
283 0.14
284 0.17
285 0.22
286 0.27
287 0.33
288 0.32
289 0.36
290 0.41
291 0.45
292 0.5
293 0.45
294 0.42
295 0.35
296 0.33
297 0.33
298 0.33
299 0.35
300 0.37
301 0.4
302 0.43
303 0.5
304 0.54
305 0.56
306 0.59
307 0.61
308 0.57
309 0.59
310 0.57
311 0.51
312 0.47
313 0.4
314 0.32
315 0.23
316 0.16
317 0.1
318 0.08
319 0.08
320 0.05
321 0.05
322 0.05
323 0.04
324 0.04
325 0.04
326 0.04
327 0.06
328 0.07
329 0.07
330 0.08
331 0.08
332 0.09
333 0.09
334 0.12
335 0.12
336 0.16
337 0.17
338 0.17
339 0.21
340 0.21
341 0.21
342 0.18
343 0.18
344 0.19
345 0.25
346 0.29
347 0.27
348 0.31
349 0.33
350 0.35
351 0.35
352 0.32
353 0.33
354 0.31
355 0.32
356 0.31
357 0.35
358 0.36
359 0.36
360 0.37
361 0.33
362 0.33
363 0.38
364 0.4
365 0.39
366 0.39
367 0.43
368 0.39
369 0.36
370 0.34
371 0.26
372 0.21
373 0.15
374 0.11
375 0.06
376 0.06
377 0.05
378 0.06
379 0.06
380 0.07
381 0.07
382 0.06
383 0.08
384 0.08
385 0.08
386 0.07
387 0.07
388 0.08
389 0.08
390 0.1
391 0.11
392 0.1
393 0.1
394 0.11
395 0.11
396 0.12
397 0.12
398 0.1
399 0.08
400 0.08
401 0.09
402 0.08
403 0.12
404 0.11
405 0.12
406 0.12
407 0.18
408 0.2
409 0.21
410 0.23
411 0.2
412 0.23
413 0.26
414 0.28
415 0.23
416 0.23
417 0.24
418 0.22
419 0.22
420 0.18
421 0.14
422 0.13
423 0.11
424 0.09
425 0.06
426 0.06
427 0.05
428 0.05
429 0.05
430 0.05
431 0.05
432 0.05
433 0.06
434 0.07
435 0.07
436 0.07
437 0.07
438 0.07
439 0.07
440 0.07
441 0.08
442 0.07
443 0.06
444 0.06
445 0.05
446 0.06
447 0.07
448 0.09
449 0.09
450 0.11
451 0.12
452 0.13
453 0.16
454 0.17
455 0.22
456 0.29
457 0.34
458 0.38
459 0.42
460 0.42
461 0.45
462 0.49
463 0.48
464 0.44
465 0.44
466 0.4
467 0.39
468 0.42
469 0.38
470 0.34
471 0.3
472 0.25
473 0.19
474 0.17
475 0.13
476 0.1
477 0.08
478 0.07
479 0.07
480 0.07
481 0.06
482 0.05
483 0.05
484 0.06
485 0.06
486 0.05
487 0.05
488 0.05
489 0.05
490 0.06
491 0.06
492 0.06
493 0.05
494 0.05
495 0.06
496 0.06
497 0.07
498 0.05
499 0.06
500 0.07
501 0.08
502 0.09
503 0.1
504 0.11