Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AXA4

Protein Details
Accession A0A2T3AXA4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPANTGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 8.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPANTGAKKQKKKWSKGKVKDKAQHAVILDKATSDRLYKDVQSYRLVTVATLVDRLKINGSLARRCLADLEEKGQIKKVVGHSKLNIYTRAVAAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.89
4 0.9
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.48
15 0.39
16 0.32
17 0.25
18 0.18
19 0.16
20 0.14
21 0.13
22 0.11
23 0.1
24 0.12
25 0.13
26 0.14
27 0.2
28 0.22
29 0.23
30 0.25
31 0.26
32 0.24
33 0.23
34 0.22
35 0.16
36 0.13
37 0.11
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.12
48 0.15
49 0.17
50 0.18
51 0.2
52 0.19
53 0.19
54 0.19
55 0.17
56 0.2
57 0.18
58 0.2
59 0.25
60 0.26
61 0.26
62 0.29
63 0.28
64 0.23
65 0.27
66 0.32
67 0.36
68 0.38
69 0.44
70 0.44
71 0.5
72 0.56
73 0.54
74 0.48
75 0.41
76 0.4
77 0.35