Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AZD5

Protein Details
Accession A0A2T3AZD5   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
24-49LAFLCRKSLGRRRWKRYKNWEESLRAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 8.5, cyto_nucl 8, cyto 6.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEEPRHTQIIFHSLYLHFSMNCYLAFLCRKSLGRRRWKRYKNWEESLRAHVASLEFCGLLHLWSFRGLEKKKGGIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.22
4 0.15
5 0.14
6 0.15
7 0.13
8 0.13
9 0.12
10 0.1
11 0.12
12 0.15
13 0.15
14 0.15
15 0.17
16 0.2
17 0.27
18 0.36
19 0.42
20 0.5
21 0.6
22 0.68
23 0.75
24 0.81
25 0.84
26 0.86
27 0.87
28 0.85
29 0.83
30 0.81
31 0.76
32 0.71
33 0.66
34 0.57
35 0.46
36 0.37
37 0.29
38 0.23
39 0.17
40 0.15
41 0.1
42 0.07
43 0.07
44 0.08
45 0.08
46 0.07
47 0.08
48 0.08
49 0.08
50 0.1
51 0.11
52 0.13
53 0.23
54 0.25
55 0.32
56 0.37