Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3BE52

Protein Details
Accession A0A2T3BE52    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-32RAESLQLHHSRRRRRWKKNLANFSRISHydrophilic
NLS Segment(s)
PositionSequence
16-23RRRRRWKK
Subcellular Location(s) nucl 16, mito_nucl 11.499, cyto_nucl 11.333, mito 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MRQTSRAESLQLHHSRRRRRWKKNLANFSRISPREMTNILETELIHSLPKLVHQAIITVYCPQKYDKMAVLKDPENLNVWLGSTLVSAVRADLRQGSSAFEALNLTSRLSIIVELGGSPTKITDLVPLITNCLIVSIGPSWNCWIFRLLCAPRLYHVYSNVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.63
3 0.7
4 0.78
5 0.79
6 0.83
7 0.88
8 0.91
9 0.94
10 0.95
11 0.96
12 0.92
13 0.89
14 0.8
15 0.74
16 0.72
17 0.62
18 0.54
19 0.46
20 0.39
21 0.35
22 0.35
23 0.32
24 0.25
25 0.25
26 0.22
27 0.2
28 0.18
29 0.16
30 0.16
31 0.13
32 0.1
33 0.09
34 0.09
35 0.08
36 0.1
37 0.11
38 0.11
39 0.12
40 0.12
41 0.13
42 0.13
43 0.14
44 0.13
45 0.14
46 0.15
47 0.13
48 0.14
49 0.14
50 0.17
51 0.17
52 0.19
53 0.2
54 0.26
55 0.26
56 0.28
57 0.31
58 0.29
59 0.31
60 0.29
61 0.24
62 0.2
63 0.2
64 0.17
65 0.13
66 0.12
67 0.08
68 0.08
69 0.07
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.06
77 0.05
78 0.06
79 0.07
80 0.08
81 0.1
82 0.1
83 0.11
84 0.11
85 0.11
86 0.11
87 0.09
88 0.09
89 0.07
90 0.1
91 0.09
92 0.08
93 0.08
94 0.08
95 0.08
96 0.08
97 0.08
98 0.05
99 0.05
100 0.05
101 0.05
102 0.06
103 0.06
104 0.06
105 0.06
106 0.05
107 0.06
108 0.06
109 0.06
110 0.08
111 0.1
112 0.11
113 0.15
114 0.15
115 0.17
116 0.17
117 0.17
118 0.13
119 0.12
120 0.1
121 0.07
122 0.09
123 0.08
124 0.12
125 0.12
126 0.13
127 0.16
128 0.19
129 0.2
130 0.19
131 0.21
132 0.19
133 0.22
134 0.3
135 0.3
136 0.34
137 0.35
138 0.35
139 0.34
140 0.38
141 0.4
142 0.34