Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q1K8V4

Protein Details
Accession Q1K8V4    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-43APAPAPAPSNKKKPKKITGPPPHSEPFHydrophilic
201-231DLYARGGLGRKKRKTRPTTMKRTESKRWLLCHydrophilic
NLS Segment(s)
PositionSequence
23-39APSNKKKPKKITGPPPH
207-221GLGRKKRKTRPTTMK
Subcellular Location(s) cyto 11, cyto_mito 10.333, cyto_nucl 9.833, mito 8.5, nucl 7.5
Family & Domain DBs
KEGG ncr:NCU08724  -  
Amino Acid Sequences MPSRQELAAPSSAPTPAPAPAPAPSNKKKPKKITGPPPHSEPFKRPYHVSKDRPMSWYRGDANRIFLWSPFSKAFPLLLLDKLPKLQPRPISDDDEPIAVNGFDATKKHFYAAQAKWERAVEIMEEEGRRMVYYGRTMHEEAQACHKWVGQVGKMTWEGHHGRMKNYDAFEEALDKVCKMNKKAVETVEEVQESTKKWPVDLYARGGLGRKKRKTRPTTMKRTESKRWLLCSFLGFKVTTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.15
3 0.14
4 0.15
5 0.15
6 0.16
7 0.18
8 0.23
9 0.28
10 0.35
11 0.41
12 0.5
13 0.59
14 0.67
15 0.75
16 0.8
17 0.84
18 0.86
19 0.89
20 0.9
21 0.91
22 0.9
23 0.84
24 0.81
25 0.76
26 0.72
27 0.65
28 0.6
29 0.56
30 0.54
31 0.53
32 0.51
33 0.54
34 0.57
35 0.63
36 0.64
37 0.66
38 0.67
39 0.67
40 0.67
41 0.61
42 0.56
43 0.49
44 0.49
45 0.45
46 0.42
47 0.42
48 0.39
49 0.41
50 0.37
51 0.35
52 0.29
53 0.24
54 0.25
55 0.21
56 0.23
57 0.2
58 0.2
59 0.19
60 0.19
61 0.19
62 0.14
63 0.15
64 0.13
65 0.13
66 0.14
67 0.14
68 0.14
69 0.15
70 0.17
71 0.19
72 0.2
73 0.25
74 0.29
75 0.32
76 0.4
77 0.42
78 0.45
79 0.42
80 0.42
81 0.37
82 0.32
83 0.27
84 0.19
85 0.16
86 0.09
87 0.08
88 0.05
89 0.05
90 0.05
91 0.05
92 0.09
93 0.11
94 0.11
95 0.12
96 0.14
97 0.16
98 0.25
99 0.26
100 0.33
101 0.34
102 0.33
103 0.34
104 0.33
105 0.3
106 0.21
107 0.2
108 0.1
109 0.07
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.06
117 0.06
118 0.07
119 0.07
120 0.11
121 0.13
122 0.14
123 0.17
124 0.19
125 0.2
126 0.24
127 0.24
128 0.2
129 0.26
130 0.26
131 0.24
132 0.23
133 0.22
134 0.18
135 0.19
136 0.22
137 0.16
138 0.19
139 0.18
140 0.21
141 0.22
142 0.22
143 0.19
144 0.22
145 0.21
146 0.23
147 0.28
148 0.26
149 0.26
150 0.31
151 0.34
152 0.32
153 0.31
154 0.27
155 0.23
156 0.23
157 0.21
158 0.19
159 0.16
160 0.16
161 0.15
162 0.15
163 0.15
164 0.18
165 0.23
166 0.23
167 0.3
168 0.31
169 0.36
170 0.41
171 0.42
172 0.42
173 0.42
174 0.42
175 0.38
176 0.33
177 0.27
178 0.24
179 0.23
180 0.2
181 0.2
182 0.23
183 0.19
184 0.19
185 0.21
186 0.25
187 0.3
188 0.33
189 0.35
190 0.34
191 0.34
192 0.35
193 0.37
194 0.38
195 0.4
196 0.46
197 0.5
198 0.56
199 0.65
200 0.75
201 0.81
202 0.86
203 0.88
204 0.89
205 0.91
206 0.91
207 0.91
208 0.89
209 0.88
210 0.87
211 0.85
212 0.84
213 0.8
214 0.76
215 0.69
216 0.63
217 0.58
218 0.53
219 0.48
220 0.4
221 0.37