Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5IPV8

Protein Details
Accession V5IPV8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
11-30VLRLYRKCLRECRKKPEATRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR045295  Complex1_LYR_SDHAF1_LYRM8  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
KEGG ncr:NCU07507  -  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20268  Complex1_LYR_SDHAF1_LYRM8  
Amino Acid Sequences MARLSGLQKEVLRLYRKCLRECRKKPEATRAHFKAFARTEFEKNIKVDKRDFSAIEFLLRKGSRQLEMYASPGVKDIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.48
4 0.51
5 0.58
6 0.61
7 0.66
8 0.74
9 0.76
10 0.78
11 0.8
12 0.79
13 0.79
14 0.79
15 0.74
16 0.75
17 0.7
18 0.65
19 0.61
20 0.56
21 0.53
22 0.46
23 0.4
24 0.36
25 0.34
26 0.32
27 0.32
28 0.34
29 0.29
30 0.28
31 0.34
32 0.32
33 0.32
34 0.34
35 0.33
36 0.35
37 0.34
38 0.34
39 0.28
40 0.29
41 0.26
42 0.27
43 0.25
44 0.21
45 0.25
46 0.25
47 0.23
48 0.24
49 0.27
50 0.26
51 0.27
52 0.29
53 0.27
54 0.29
55 0.3
56 0.3
57 0.27
58 0.24