Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3BDY4

Protein Details
Accession A0A2T3BDY4   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-32VSRACLPCHSAKRKCNKARPCSQCLKRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences RTRNRVSRACLPCHSAKRKCNKARPCSQCLKRQITSNCIYESVTDADLEALEAADPGLLSENQVLRSRVGELETAIAALR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.66
3 0.67
4 0.71
5 0.79
6 0.83
7 0.84
8 0.84
9 0.84
10 0.86
11 0.85
12 0.82
13 0.82
14 0.79
15 0.77
16 0.76
17 0.73
18 0.65
19 0.65
20 0.61
21 0.57
22 0.54
23 0.48
24 0.4
25 0.33
26 0.3
27 0.22
28 0.21
29 0.16
30 0.12
31 0.09
32 0.08
33 0.07
34 0.07
35 0.07
36 0.05
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.05
45 0.05
46 0.06
47 0.08
48 0.1
49 0.13
50 0.17
51 0.18
52 0.17
53 0.18
54 0.2
55 0.19
56 0.18
57 0.16
58 0.14
59 0.15
60 0.14