Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3B7X3

Protein Details
Accession A0A2T3B7X3    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
74-102IIPRPGTPNQTQQRRRKRTNARSTRSAVAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, nucl 7, mito 7, mito_nucl 7
Family & Domain DBs
Amino Acid Sequences MELRMAWQCCLVDGQLAASSALCFLWSRRGFALHDGLARRARNGAPGILGLWEPWETWHWQQSLPTTTTRRARIIPRPGTPNQTQQRRRKRTNARSTRSAVAGAVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.12
4 0.11
5 0.1
6 0.09
7 0.08
8 0.08
9 0.07
10 0.06
11 0.06
12 0.16
13 0.17
14 0.19
15 0.2
16 0.23
17 0.23
18 0.26
19 0.3
20 0.21
21 0.24
22 0.23
23 0.25
24 0.27
25 0.26
26 0.24
27 0.22
28 0.2
29 0.21
30 0.21
31 0.18
32 0.14
33 0.13
34 0.13
35 0.11
36 0.11
37 0.06
38 0.06
39 0.06
40 0.05
41 0.06
42 0.07
43 0.09
44 0.1
45 0.14
46 0.14
47 0.15
48 0.16
49 0.2
50 0.22
51 0.22
52 0.25
53 0.24
54 0.29
55 0.34
56 0.36
57 0.35
58 0.36
59 0.41
60 0.46
61 0.53
62 0.55
63 0.54
64 0.57
65 0.58
66 0.6
67 0.57
68 0.58
69 0.57
70 0.6
71 0.65
72 0.69
73 0.77
74 0.8
75 0.85
76 0.86
77 0.88
78 0.88
79 0.9
80 0.91
81 0.88
82 0.86
83 0.83
84 0.77
85 0.67
86 0.57