Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3AXP4

Protein Details
Accession A0A2T3AXP4    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
41-70RREIQKKIGKKKSDNRRKPPCRAVPCKQSSBasic
NLS Segment(s)
PositionSequence
43-59EIQKKIGKKKSDNRRKP
Subcellular Location(s) mito 14, nucl 6.5, cyto_nucl 6.5, cyto 5.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFFHHRDIPSVSESSFPEAAAAAMLKYGWVVGFIPYVLVARREIQKKIGKKKSDNRRKPPCRAVPCKQSSSAIISSFKLRVYQIYPMVLPCGRYLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.2
4 0.16
5 0.15
6 0.14
7 0.11
8 0.1
9 0.05
10 0.05
11 0.05
12 0.04
13 0.04
14 0.04
15 0.03
16 0.04
17 0.04
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.06
24 0.06
25 0.06
26 0.07
27 0.09
28 0.15
29 0.18
30 0.19
31 0.26
32 0.32
33 0.39
34 0.49
35 0.55
36 0.55
37 0.61
38 0.7
39 0.73
40 0.78
41 0.81
42 0.81
43 0.84
44 0.86
45 0.87
46 0.88
47 0.86
48 0.85
49 0.84
50 0.81
51 0.8
52 0.78
53 0.73
54 0.65
55 0.57
56 0.49
57 0.45
58 0.4
59 0.32
60 0.27
61 0.25
62 0.26
63 0.25
64 0.24
65 0.2
66 0.18
67 0.19
68 0.2
69 0.25
70 0.25
71 0.27
72 0.27
73 0.26
74 0.29
75 0.27
76 0.25