Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7S3V2

Protein Details
Accession Q7S3V2   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-37LPTSKVRSPNSSRHRHREASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 8, cyto 4
Family & Domain DBs
KEGG ncr:NCU04915  -  
Amino Acid Sequences MTVMKWWHLLKSASQANLPTSKVRSPNSSRHRHREASSSGKVSGPASRCDNATLTNGTTARPQFSTTTGQSGHHRGNLDHQLLNIRGGDGYCLVCNPWYADKNPNLQNEDPNSLPQISTEHGYVLLEGQPSVLPPSRAEGNYFTKVDIRGDSNNMELILDTALVANPNRARSSRYEKVDIHLPLDHKASSEPATLIVSELLQLNPKGRRYTTGSPLSDSQLSYESHFGCGKTGFNTEETQVVLSMARALRVRNKCSPSSTFSKNWGFHLLLFIKAQISRSLRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.36
4 0.39
5 0.37
6 0.33
7 0.31
8 0.35
9 0.4
10 0.41
11 0.46
12 0.49
13 0.57
14 0.63
15 0.7
16 0.73
17 0.76
18 0.81
19 0.78
20 0.74
21 0.72
22 0.69
23 0.68
24 0.65
25 0.58
26 0.51
27 0.46
28 0.44
29 0.37
30 0.35
31 0.29
32 0.27
33 0.29
34 0.29
35 0.29
36 0.29
37 0.29
38 0.25
39 0.26
40 0.23
41 0.19
42 0.22
43 0.22
44 0.2
45 0.24
46 0.23
47 0.22
48 0.21
49 0.22
50 0.19
51 0.22
52 0.27
53 0.23
54 0.27
55 0.25
56 0.27
57 0.29
58 0.32
59 0.31
60 0.29
61 0.29
62 0.25
63 0.31
64 0.36
65 0.35
66 0.31
67 0.29
68 0.29
69 0.28
70 0.29
71 0.22
72 0.15
73 0.12
74 0.11
75 0.11
76 0.08
77 0.09
78 0.07
79 0.07
80 0.07
81 0.07
82 0.08
83 0.09
84 0.13
85 0.15
86 0.17
87 0.23
88 0.27
89 0.34
90 0.39
91 0.42
92 0.41
93 0.4
94 0.42
95 0.39
96 0.39
97 0.32
98 0.27
99 0.24
100 0.2
101 0.18
102 0.14
103 0.12
104 0.1
105 0.1
106 0.1
107 0.08
108 0.08
109 0.08
110 0.08
111 0.07
112 0.07
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.08
119 0.08
120 0.08
121 0.08
122 0.1
123 0.12
124 0.13
125 0.14
126 0.17
127 0.21
128 0.23
129 0.24
130 0.22
131 0.21
132 0.21
133 0.2
134 0.17
135 0.15
136 0.13
137 0.14
138 0.15
139 0.13
140 0.13
141 0.12
142 0.11
143 0.08
144 0.07
145 0.05
146 0.04
147 0.04
148 0.04
149 0.04
150 0.05
151 0.05
152 0.07
153 0.09
154 0.11
155 0.12
156 0.13
157 0.15
158 0.21
159 0.3
160 0.35
161 0.38
162 0.42
163 0.41
164 0.43
165 0.48
166 0.43
167 0.36
168 0.31
169 0.28
170 0.24
171 0.25
172 0.22
173 0.15
174 0.15
175 0.15
176 0.14
177 0.14
178 0.12
179 0.12
180 0.12
181 0.12
182 0.11
183 0.09
184 0.07
185 0.07
186 0.08
187 0.07
188 0.08
189 0.09
190 0.13
191 0.17
192 0.21
193 0.23
194 0.23
195 0.28
196 0.33
197 0.4
198 0.44
199 0.49
200 0.47
201 0.47
202 0.48
203 0.46
204 0.4
205 0.33
206 0.26
207 0.2
208 0.2
209 0.18
210 0.21
211 0.18
212 0.19
213 0.21
214 0.19
215 0.18
216 0.19
217 0.18
218 0.17
219 0.19
220 0.18
221 0.18
222 0.2
223 0.19
224 0.19
225 0.18
226 0.17
227 0.14
228 0.12
229 0.1
230 0.09
231 0.12
232 0.11
233 0.13
234 0.14
235 0.17
236 0.26
237 0.34
238 0.4
239 0.45
240 0.5
241 0.51
242 0.56
243 0.59
244 0.56
245 0.56
246 0.56
247 0.51
248 0.53
249 0.58
250 0.54
251 0.52
252 0.51
253 0.45
254 0.39
255 0.43
256 0.37
257 0.3
258 0.29
259 0.26
260 0.24
261 0.24
262 0.25
263 0.24