Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3BES1

Protein Details
Accession A0A2T3BES1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-51RSFFYPCMQKEQKKKKRKKKGRTPLMYKNIYHydrophilic
NLS Segment(s)
PositionSequence
32-42QKKKKRKKKGR
Subcellular Location(s) mito 19.5, mito_nucl 13.5, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MPSVIHPFGNYLSPFVRSFVRSFFYPCMQKEQKKKKRKKKGRTPLMYKNIYACICRRDIKSSPFPASPPPLLQNAPHMYNEIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.22
4 0.19
5 0.2
6 0.21
7 0.23
8 0.21
9 0.24
10 0.25
11 0.28
12 0.31
13 0.31
14 0.37
15 0.41
16 0.47
17 0.54
18 0.62
19 0.67
20 0.73
21 0.83
22 0.84
23 0.88
24 0.93
25 0.93
26 0.93
27 0.94
28 0.94
29 0.93
30 0.91
31 0.9
32 0.87
33 0.78
34 0.67
35 0.58
36 0.52
37 0.43
38 0.36
39 0.27
40 0.22
41 0.23
42 0.27
43 0.27
44 0.29
45 0.34
46 0.4
47 0.47
48 0.5
49 0.51
50 0.48
51 0.47
52 0.46
53 0.47
54 0.42
55 0.36
56 0.33
57 0.32
58 0.32
59 0.32
60 0.35
61 0.34
62 0.34
63 0.31