Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3AUU1

Protein Details
Accession A0A2T3AUU1    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-37VREWCEKWKRTHRCRFAYYRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12, nucl 10.5, cyto 10.5, mito 4
Family & Domain DBs
Amino Acid Sequences MCDYTEVEFRCGHRRFVVREWCEKWKRTHRCRFAYYRDVVGITFILERRCGDCNRGTKRFVSMSHVGKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.49
4 0.57
5 0.52
6 0.58
7 0.6
8 0.63
9 0.63
10 0.62
11 0.62
12 0.63
13 0.69
14 0.71
15 0.77
16 0.76
17 0.78
18 0.8
19 0.78
20 0.75
21 0.71
22 0.62
23 0.53
24 0.44
25 0.37
26 0.3
27 0.23
28 0.16
29 0.09
30 0.09
31 0.09
32 0.09
33 0.09
34 0.1
35 0.12
36 0.16
37 0.17
38 0.2
39 0.25
40 0.34
41 0.42
42 0.47
43 0.47
44 0.45
45 0.5
46 0.51
47 0.46
48 0.44
49 0.43