Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3BAA8

Protein Details
Accession A0A2T3BAA8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKRSKKTTHIKFKVRCQRHHydrophilic
NLS Segment(s)
PositionSequence
25-29IKRSK
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREISDIKNFIEICRRKDASSARIKRSKKTTHIKFKVRCQRHLYTLVLKDAEKAEKLKQSLPPSMSSSPWCNSRARARRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.42
4 0.37
5 0.44
6 0.49
7 0.48
8 0.54
9 0.58
10 0.57
11 0.64
12 0.65
13 0.66
14 0.69
15 0.68
16 0.66
17 0.69
18 0.71
19 0.74
20 0.81
21 0.84
22 0.8
23 0.82
24 0.83
25 0.77
26 0.74
27 0.69
28 0.64
29 0.59
30 0.57
31 0.5
32 0.45
33 0.43
34 0.38
35 0.32
36 0.28
37 0.25
38 0.22
39 0.22
40 0.17
41 0.17
42 0.19
43 0.23
44 0.25
45 0.27
46 0.32
47 0.36
48 0.4
49 0.4
50 0.4
51 0.4
52 0.41
53 0.39
54 0.36
55 0.36
56 0.33
57 0.36
58 0.35
59 0.32
60 0.36
61 0.45