Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AQG5

Protein Details
Accession A0A2T3AQG5    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
207-246DEPKPKKEPSGRPRGRPAKPDSEKKTKKPAVPGRGRGRPRBasic
250-272KVPPKPPTTGEPRKRGRPPKDGGBasic
NLS Segment(s)
PositionSequence
209-280PKPKKEPSGRPRGRPAKPDSEKKTKKPAVPGRGRGRPRGSTKVPPKPPTTGEPRKRGRPPKDGGGAAKSNKR
Subcellular Location(s) nucl 16, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MAAADLITLPEFRDALSRYPALISSLTKPAKAGVATLEELDQFRYVDAPSRFSKKAGGKTLELADVQKLVDWKLRHGTFRPTLPKLVASNSDDVVRDATSDAFSHYDNDPSDISKTIDKLTKPLKGIGPAAGSLILSIHDPENVIFFSDEAYRWLVKGGEKTKILYNSSEFEELYNKAKELKNRLQVSPIDIEKVAYVLIRESEPADEPKPKKEPSGRPRGRPAKPDSEKKTKKPAVPGRGRGRPRGSTKVPPKPPTTGEPRKRGRPPKDGGGAAKSNKRQATEEAQDPGSAHDEKRAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.25
4 0.25
5 0.24
6 0.25
7 0.25
8 0.22
9 0.22
10 0.21
11 0.19
12 0.28
13 0.28
14 0.28
15 0.27
16 0.26
17 0.28
18 0.25
19 0.22
20 0.16
21 0.19
22 0.19
23 0.19
24 0.19
25 0.16
26 0.16
27 0.16
28 0.14
29 0.1
30 0.1
31 0.1
32 0.1
33 0.17
34 0.18
35 0.21
36 0.25
37 0.31
38 0.32
39 0.32
40 0.4
41 0.39
42 0.47
43 0.51
44 0.51
45 0.46
46 0.49
47 0.5
48 0.45
49 0.38
50 0.3
51 0.22
52 0.18
53 0.16
54 0.14
55 0.12
56 0.12
57 0.16
58 0.16
59 0.18
60 0.26
61 0.29
62 0.31
63 0.33
64 0.4
65 0.4
66 0.47
67 0.51
68 0.45
69 0.45
70 0.42
71 0.43
72 0.36
73 0.35
74 0.32
75 0.27
76 0.26
77 0.24
78 0.24
79 0.21
80 0.2
81 0.18
82 0.13
83 0.11
84 0.09
85 0.09
86 0.08
87 0.08
88 0.09
89 0.09
90 0.09
91 0.11
92 0.11
93 0.14
94 0.13
95 0.15
96 0.14
97 0.14
98 0.15
99 0.14
100 0.15
101 0.13
102 0.14
103 0.15
104 0.18
105 0.17
106 0.22
107 0.26
108 0.29
109 0.29
110 0.31
111 0.3
112 0.29
113 0.3
114 0.26
115 0.22
116 0.17
117 0.16
118 0.13
119 0.11
120 0.08
121 0.07
122 0.05
123 0.04
124 0.05
125 0.04
126 0.04
127 0.05
128 0.05
129 0.06
130 0.06
131 0.06
132 0.05
133 0.05
134 0.06
135 0.07
136 0.07
137 0.07
138 0.08
139 0.08
140 0.08
141 0.09
142 0.09
143 0.1
144 0.16
145 0.17
146 0.2
147 0.21
148 0.22
149 0.25
150 0.27
151 0.27
152 0.22
153 0.22
154 0.19
155 0.21
156 0.2
157 0.17
158 0.14
159 0.15
160 0.15
161 0.17
162 0.15
163 0.14
164 0.18
165 0.2
166 0.24
167 0.31
168 0.37
169 0.43
170 0.46
171 0.47
172 0.46
173 0.45
174 0.43
175 0.39
176 0.31
177 0.24
178 0.2
179 0.2
180 0.15
181 0.14
182 0.11
183 0.06
184 0.06
185 0.05
186 0.06
187 0.06
188 0.07
189 0.07
190 0.08
191 0.1
192 0.13
193 0.15
194 0.23
195 0.24
196 0.3
197 0.36
198 0.36
199 0.42
200 0.48
201 0.56
202 0.58
203 0.68
204 0.68
205 0.69
206 0.79
207 0.81
208 0.77
209 0.75
210 0.73
211 0.72
212 0.73
213 0.77
214 0.74
215 0.76
216 0.78
217 0.76
218 0.8
219 0.76
220 0.73
221 0.74
222 0.75
223 0.75
224 0.77
225 0.8
226 0.78
227 0.81
228 0.8
229 0.77
230 0.74
231 0.71
232 0.69
233 0.68
234 0.65
235 0.66
236 0.72
237 0.74
238 0.77
239 0.75
240 0.72
241 0.69
242 0.67
243 0.64
244 0.64
245 0.64
246 0.64
247 0.68
248 0.72
249 0.75
250 0.81
251 0.85
252 0.83
253 0.82
254 0.8
255 0.79
256 0.79
257 0.75
258 0.69
259 0.66
260 0.63
261 0.59
262 0.61
263 0.56
264 0.55
265 0.54
266 0.52
267 0.48
268 0.47
269 0.51
270 0.5
271 0.5
272 0.47
273 0.45
274 0.42
275 0.39
276 0.35
277 0.3
278 0.26
279 0.21
280 0.25