Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7SEM9

Protein Details
Accession Q7SEM9    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
298-322GGRRGRKRGVPGGGKKKNRRPEYDSBasic
NLS Segment(s)
PositionSequence
263-289RERAKAQRRRETAAARVDGAGGRFKGG
296-317LEGGRRGRKRGVPGGGKKKNRR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR007149  Leo1  
Gene Ontology GO:0016593  C:Cdc73/Paf1 complex  
GO:0005634  C:nucleus  
GO:1990269  F:RNA polymerase II C-terminal domain phosphoserine binding  
GO:0016570  P:histone modification  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG ncr:NCU03315  -  
Pfam View protein in Pfam  
PF04004  Leo1  
Amino Acid Sequences MSDSEDHIDNVPDDAGDDLFGDEDVNDDQPLSEIGEDKLSDRDLNSDREDDVADRHHDEADGMEDEEPEFRSKTVADTPLYRHRIPKSEDGSLYSFKVPDFIKLNPLEYNSDTWEPSKWDLRNARAETPIPSVMRRRDPKTGKMQSNTNIYRWSDGSVTMAVGDEHYEIQSKPLAPPPNKPYQEVQDAHYYAAAAHLTTNSLVIIGHFTEQYMLRPNKNIQDHALERLKAELATAKKERGPDMIILAKEDPELQKKQAEMAERERAKAQRRRETAAARVDGAGGRFKGGALSIGDLEGGRRGRKRGVPGGGKKKNRRPEYDSDDELPGGVRNTDKYDLDDGFLVDSDEESEEVVDDEEEEELLDDDDEEEEEAPRRKRQRTAEADDEDGAGTTSHRRRRAIVDDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.08
5 0.07
6 0.07
7 0.07
8 0.07
9 0.05
10 0.07
11 0.08
12 0.09
13 0.09
14 0.08
15 0.08
16 0.09
17 0.1
18 0.09
19 0.09
20 0.1
21 0.1
22 0.14
23 0.14
24 0.14
25 0.16
26 0.17
27 0.17
28 0.16
29 0.22
30 0.23
31 0.28
32 0.3
33 0.29
34 0.28
35 0.28
36 0.28
37 0.22
38 0.21
39 0.21
40 0.21
41 0.22
42 0.22
43 0.22
44 0.2
45 0.2
46 0.18
47 0.16
48 0.14
49 0.13
50 0.12
51 0.12
52 0.12
53 0.13
54 0.14
55 0.12
56 0.12
57 0.11
58 0.12
59 0.12
60 0.15
61 0.2
62 0.24
63 0.24
64 0.27
65 0.33
66 0.42
67 0.48
68 0.45
69 0.45
70 0.46
71 0.52
72 0.53
73 0.56
74 0.51
75 0.52
76 0.52
77 0.49
78 0.48
79 0.42
80 0.39
81 0.31
82 0.27
83 0.2
84 0.23
85 0.19
86 0.2
87 0.22
88 0.2
89 0.27
90 0.27
91 0.29
92 0.27
93 0.28
94 0.27
95 0.25
96 0.26
97 0.22
98 0.23
99 0.22
100 0.21
101 0.21
102 0.2
103 0.22
104 0.27
105 0.24
106 0.3
107 0.35
108 0.4
109 0.48
110 0.49
111 0.49
112 0.45
113 0.45
114 0.4
115 0.38
116 0.36
117 0.28
118 0.27
119 0.3
120 0.32
121 0.4
122 0.44
123 0.44
124 0.5
125 0.54
126 0.6
127 0.65
128 0.69
129 0.66
130 0.63
131 0.64
132 0.59
133 0.64
134 0.58
135 0.49
136 0.44
137 0.37
138 0.35
139 0.3
140 0.27
141 0.18
142 0.16
143 0.16
144 0.11
145 0.11
146 0.09
147 0.08
148 0.06
149 0.06
150 0.06
151 0.05
152 0.05
153 0.05
154 0.07
155 0.06
156 0.08
157 0.1
158 0.1
159 0.11
160 0.17
161 0.24
162 0.24
163 0.32
164 0.37
165 0.44
166 0.45
167 0.46
168 0.43
169 0.4
170 0.47
171 0.41
172 0.37
173 0.34
174 0.33
175 0.3
176 0.28
177 0.23
178 0.14
179 0.14
180 0.12
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.05
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.05
194 0.05
195 0.05
196 0.06
197 0.06
198 0.07
199 0.15
200 0.16
201 0.17
202 0.2
203 0.22
204 0.28
205 0.3
206 0.3
207 0.24
208 0.29
209 0.29
210 0.32
211 0.34
212 0.27
213 0.25
214 0.24
215 0.23
216 0.16
217 0.15
218 0.14
219 0.12
220 0.17
221 0.19
222 0.19
223 0.21
224 0.23
225 0.24
226 0.22
227 0.22
228 0.17
229 0.19
230 0.21
231 0.19
232 0.19
233 0.18
234 0.16
235 0.14
236 0.15
237 0.14
238 0.15
239 0.17
240 0.17
241 0.19
242 0.19
243 0.23
244 0.24
245 0.26
246 0.26
247 0.3
248 0.38
249 0.36
250 0.37
251 0.38
252 0.41
253 0.45
254 0.47
255 0.51
256 0.51
257 0.55
258 0.59
259 0.61
260 0.61
261 0.59
262 0.59
263 0.51
264 0.42
265 0.38
266 0.33
267 0.28
268 0.24
269 0.2
270 0.12
271 0.12
272 0.11
273 0.1
274 0.1
275 0.09
276 0.1
277 0.08
278 0.09
279 0.08
280 0.08
281 0.09
282 0.08
283 0.08
284 0.1
285 0.12
286 0.14
287 0.17
288 0.2
289 0.26
290 0.31
291 0.38
292 0.43
293 0.5
294 0.56
295 0.64
296 0.72
297 0.76
298 0.8
299 0.83
300 0.84
301 0.85
302 0.83
303 0.81
304 0.77
305 0.78
306 0.77
307 0.75
308 0.7
309 0.63
310 0.56
311 0.48
312 0.4
313 0.31
314 0.23
315 0.16
316 0.13
317 0.11
318 0.11
319 0.16
320 0.19
321 0.19
322 0.21
323 0.25
324 0.24
325 0.25
326 0.23
327 0.19
328 0.17
329 0.16
330 0.13
331 0.08
332 0.08
333 0.08
334 0.08
335 0.07
336 0.07
337 0.07
338 0.07
339 0.07
340 0.07
341 0.06
342 0.06
343 0.06
344 0.06
345 0.06
346 0.06
347 0.06
348 0.06
349 0.06
350 0.06
351 0.05
352 0.06
353 0.06
354 0.07
355 0.07
356 0.07
357 0.08
358 0.13
359 0.19
360 0.23
361 0.3
362 0.39
363 0.44
364 0.53
365 0.61
366 0.67
367 0.71
368 0.77
369 0.78
370 0.74
371 0.71
372 0.63
373 0.54
374 0.43
375 0.33
376 0.24
377 0.14
378 0.11
379 0.17
380 0.24
381 0.31
382 0.37
383 0.4
384 0.44
385 0.52
386 0.61
387 0.61