FuNGI

Q7SCE5

Protein Details

Accession

Q7SCE5

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
469-490	FWGSNYPRLKQLRKKWDPLGVF	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

extr 25

Family & Domain DBs

InterPro	View protein in InterPro IPR012951 BBE IPR036318 FAD-bd_PCMH-like_sf IPR016169 FAD-bd_PCMH_sub2 IPR006094 Oxid_FAD_bind_N
Gene Ontology	GO:0050660 F:flavin adenine dinucleotide binding GO:0016491 F:oxidoreductase activity
KEGG	ncr:NCU08750 -
Pfam	View protein in Pfam PF08031 BBE PF01565 FAD_binding_4

Amino Acid Sequences

MMWQTSLGAAAAVFSLLTSQVVGQEDIQTEAQTAQIESTKGVILDSILDWNDAARLDPTTYNGQKYGCKCYPGRPCWPSANKWNSLNRTVDGTLRVNVPAGAVCHNTFDGPFGTIQTYDEAACADAKENLVNEQWTVEKPADGLWTYFTNDTCRPTSNPSDPCTLGSYGVYVIMATKASHIQAGVNFARRNNLRLIVRNTGHDFLGRSVGYGSLIINTHSFQSLKWTDKYTGPGSYRGPAVTMGAGVQGGDILKAGHALNPPMALVTGECATVGLSGGLLITASGLIVNANERARPRPLLCSEGRRPGIVARGRHVEPKIFHKYANHHFVDNGLYVYTYFEIFPGQFRVRPFVAIGKDQFQLENILRPICSMSSLLPVSHHHRYEERGQPGWQTGFVWRHAAAHPAWRNATDFVIAVLPSPEHPSLAVKKDLQNVLTNNMDEGLRNASRSGATYVNEADPFQPNWQSHFWGSNYPRLKQLRKKWDPLGVFYAVSTPGTENWEEIEFNTRLCKKL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.04
2	0.05
3	0.05
4	0.05
5	0.05
6	0.05
7	0.09
8	0.11
9	0.12
10	0.12
11	0.16
12	0.16
13	0.19
14	0.19
15	0.16
16	0.15
17	0.15
18	0.15
19	0.13
20	0.12
21	0.11
22	0.14
23	0.14
24	0.14
25	0.15
26	0.14
27	0.13
28	0.13
29	0.11
30	0.08
31	0.1
32	0.1
33	0.12
34	0.11
35	0.11
36	0.11
37	0.11
38	0.12
39	0.1
40	0.1
41	0.08
42	0.1
43	0.12
44	0.13
45	0.16
46	0.24
47	0.27
48	0.29
49	0.31
50	0.32
51	0.36
52	0.39
53	0.45
54	0.39
55	0.42
56	0.42
57	0.49
58	0.57
59	0.58
60	0.64
61	0.59
62	0.6
63	0.65
64	0.69
65	0.67
66	0.67
67	0.68
68	0.64
69	0.67
70	0.7
71	0.66
72	0.65
73	0.61
74	0.51
75	0.48
76	0.43
77	0.38
78	0.34
79	0.31
80	0.27
81	0.25
82	0.24
83	0.19
84	0.18
85	0.16
86	0.13
87	0.12
88	0.13
89	0.13
90	0.13
91	0.15
92	0.15
93	0.15
94	0.13
95	0.14
96	0.12
97	0.11
98	0.11
99	0.1
100	0.11
101	0.11
102	0.12
103	0.12
104	0.12
105	0.1
106	0.1
107	0.09
108	0.09
109	0.09
110	0.09
111	0.08
112	0.08
113	0.09
114	0.1
115	0.1
116	0.11
117	0.12
118	0.12
119	0.12
120	0.11
121	0.12
122	0.12
123	0.14
124	0.13
125	0.12
126	0.11
127	0.13
128	0.14
129	0.13
130	0.13
131	0.12
132	0.13
133	0.15
134	0.16
135	0.15
136	0.17
137	0.19
138	0.22
139	0.22
140	0.23
141	0.24
142	0.28
143	0.34
144	0.38
145	0.41
146	0.4
147	0.42
148	0.4
149	0.4
150	0.37
151	0.31
152	0.23
153	0.18
154	0.16
155	0.12
156	0.11
157	0.09
158	0.06
159	0.05
160	0.05
161	0.06
162	0.05
163	0.06
164	0.07
165	0.07
166	0.08
167	0.08
168	0.09
169	0.09
170	0.15
171	0.16
172	0.2
173	0.21
174	0.21
175	0.27
176	0.26
177	0.28
178	0.24
179	0.29
180	0.26
181	0.32
182	0.37
183	0.37
184	0.38
185	0.38
186	0.39
187	0.34
188	0.31
189	0.25
190	0.21
191	0.15
192	0.18
193	0.14
194	0.12
195	0.11
196	0.11
197	0.1
198	0.09
199	0.08
200	0.06
201	0.07
202	0.07
203	0.07
204	0.07
205	0.08
206	0.09
207	0.09
208	0.07
209	0.14
210	0.17
211	0.2
212	0.22
213	0.24
214	0.25
215	0.27
216	0.32
217	0.27
218	0.28
219	0.26
220	0.28
221	0.26
222	0.26
223	0.24
224	0.2
225	0.18
226	0.13
227	0.12
228	0.09
229	0.07
230	0.06
231	0.05
232	0.05
233	0.04
234	0.03
235	0.03
236	0.03
237	0.03
238	0.03
239	0.03
240	0.03
241	0.04
242	0.04
243	0.06
244	0.07
245	0.08
246	0.08
247	0.08
248	0.08
249	0.07
250	0.07
251	0.05
252	0.04
253	0.05
254	0.05
255	0.04
256	0.04
257	0.04
258	0.04
259	0.04
260	0.04
261	0.03
262	0.03
263	0.03
264	0.03
265	0.02
266	0.02
267	0.02
268	0.02
269	0.02
270	0.02
271	0.02
272	0.02
273	0.02
274	0.02
275	0.03
276	0.06
277	0.06
278	0.08
279	0.1
280	0.12
281	0.15
282	0.18
283	0.19
284	0.23
285	0.25
286	0.3
287	0.31
288	0.37
289	0.39
290	0.44
291	0.44
292	0.37
293	0.35
294	0.31
295	0.36
296	0.33
297	0.3
298	0.25
299	0.29
300	0.3
301	0.34
302	0.34
303	0.3
304	0.27
305	0.34
306	0.39
307	0.35
308	0.36
309	0.35
310	0.42
311	0.46
312	0.52
313	0.45
314	0.37
315	0.36
316	0.36
317	0.33
318	0.26
319	0.18
320	0.1
321	0.09
322	0.08
323	0.09
324	0.08
325	0.07
326	0.06
327	0.06
328	0.07
329	0.07
330	0.08
331	0.13
332	0.14
333	0.16
334	0.17
335	0.22
336	0.21
337	0.22
338	0.21
339	0.22
340	0.23
341	0.25
342	0.25
343	0.24
344	0.25
345	0.24
346	0.23
347	0.18
348	0.2
349	0.16
350	0.2
351	0.18
352	0.18
353	0.17
354	0.17
355	0.18
356	0.14
357	0.14
358	0.1
359	0.09
360	0.14
361	0.15
362	0.14
363	0.15
364	0.19
365	0.23
366	0.29
367	0.29
368	0.27
369	0.28
370	0.33
371	0.4
372	0.45
373	0.43
374	0.4
375	0.4
376	0.4
377	0.42
378	0.38
379	0.3
380	0.23
381	0.24
382	0.24
383	0.24
384	0.25
385	0.21
386	0.23
387	0.23
388	0.25
389	0.2
390	0.27
391	0.3
392	0.31
393	0.32
394	0.3
395	0.32
396	0.3
397	0.3
398	0.21
399	0.17
400	0.13
401	0.13
402	0.12
403	0.1
404	0.1
405	0.09
406	0.09
407	0.14
408	0.13
409	0.12
410	0.13
411	0.18
412	0.23
413	0.27
414	0.31
415	0.3
416	0.35
417	0.42
418	0.45
419	0.41
420	0.41
421	0.39
422	0.39
423	0.38
424	0.33
425	0.26
426	0.24
427	0.22
428	0.16
429	0.16
430	0.17
431	0.15
432	0.16
433	0.16
434	0.16
435	0.17
436	0.19
437	0.2
438	0.18
439	0.18
440	0.2
441	0.22
442	0.24
443	0.24
444	0.22
445	0.21
446	0.22
447	0.23
448	0.24
449	0.27
450	0.25
451	0.29
452	0.31
453	0.34
454	0.32
455	0.36
456	0.34
457	0.37
458	0.4
459	0.44
460	0.46
461	0.44
462	0.5
463	0.53
464	0.61
465	0.61
466	0.69
467	0.72
468	0.76
469	0.83
470	0.81
471	0.82
472	0.76
473	0.72
474	0.67
475	0.58
476	0.49
477	0.4
478	0.35
479	0.27
480	0.23
481	0.18
482	0.14
483	0.13
484	0.17
485	0.18
486	0.16
487	0.17
488	0.19
489	0.18
490	0.18
491	0.23
492	0.19
493	0.2
494	0.28

Q7SCE5

3D AlphaFold-predicted Structure Viewer