Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q1K5C8

Protein Details
Accession Q1K5C8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-90SDRWSPVWRRWKSHQRKLKQVNGSRTAVHydrophilic
NLS Segment(s)
PositionSequence
49-80KKVRPKKDRAGDRGSDRWSPVWRRWKSHQRKL
Subcellular Location(s) nucl 17.5, cyto_nucl 11.833, mito_nucl 11.666, mito 4.5
Family & Domain DBs
KEGG ncr:NCU03547  -  
Amino Acid Sequences MEMGWNRGCYGSGPVSWYTTKWLRAELEFPSRERRCWLTGQDSIDNEAKKVRPKKDRAGDRGSDRWSPVWRRWKSHQRKLKQVNGSRTAVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.23
4 0.22
5 0.23
6 0.25
7 0.28
8 0.26
9 0.28
10 0.27
11 0.28
12 0.31
13 0.29
14 0.33
15 0.3
16 0.31
17 0.37
18 0.36
19 0.35
20 0.36
21 0.35
22 0.3
23 0.32
24 0.35
25 0.31
26 0.33
27 0.36
28 0.35
29 0.32
30 0.32
31 0.31
32 0.27
33 0.21
34 0.2
35 0.18
36 0.23
37 0.3
38 0.35
39 0.41
40 0.48
41 0.58
42 0.65
43 0.73
44 0.72
45 0.73
46 0.7
47 0.67
48 0.66
49 0.6
50 0.52
51 0.44
52 0.41
53 0.4
54 0.4
55 0.42
56 0.47
57 0.48
58 0.53
59 0.61
60 0.69
61 0.74
62 0.79
63 0.81
64 0.8
65 0.86
66 0.89
67 0.88
68 0.87
69 0.85
70 0.85
71 0.81