Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AZW0

Protein Details
Accession A0A2T3AZW0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-68GEMPDGTPRKRRRRKCVTNEGEQIHydrophilic
NLS Segment(s)
PositionSequence
53-58RKRRRR
Subcellular Location(s) mito 7extr 7, golg 5, plas 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MPPHLHPRSRYTSSLFATTLFASFFVVALPHILPCPAPRIAYADGEMPDGTPRKRRRRKCVTNEGEQIEPLKEASVAEDISDDGAASLTRMPKPKRECPVPKPGGLVGEILGFQPSSSDGDGKGRPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.42
3 0.34
4 0.31
5 0.28
6 0.23
7 0.15
8 0.13
9 0.1
10 0.09
11 0.08
12 0.06
13 0.06
14 0.05
15 0.07
16 0.07
17 0.06
18 0.07
19 0.07
20 0.07
21 0.08
22 0.12
23 0.12
24 0.12
25 0.12
26 0.17
27 0.18
28 0.19
29 0.19
30 0.17
31 0.17
32 0.17
33 0.16
34 0.12
35 0.12
36 0.14
37 0.14
38 0.2
39 0.29
40 0.4
41 0.5
42 0.59
43 0.67
44 0.76
45 0.86
46 0.87
47 0.89
48 0.84
49 0.82
50 0.79
51 0.7
52 0.59
53 0.48
54 0.39
55 0.27
56 0.22
57 0.13
58 0.08
59 0.06
60 0.06
61 0.06
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.05
70 0.03
71 0.04
72 0.04
73 0.04
74 0.06
75 0.09
76 0.12
77 0.2
78 0.22
79 0.3
80 0.38
81 0.46
82 0.53
83 0.61
84 0.68
85 0.68
86 0.77
87 0.74
88 0.68
89 0.63
90 0.55
91 0.46
92 0.37
93 0.31
94 0.2
95 0.16
96 0.14
97 0.11
98 0.1
99 0.08
100 0.07
101 0.07
102 0.07
103 0.09
104 0.1
105 0.11
106 0.12
107 0.18