Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7SG75

Protein Details
Accession Q7SG75    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
293-315FFEKLRIKEKKPMTKHRQDMEEIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 11, mito 6, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010982  Lambda_DNA-bd_dom_sf  
Gene Ontology GO:0003677  F:DNA binding  
KEGG ncr:NCU10933  -  
Amino Acid Sequences MSNSRLGVLRDAPEAARNNALSSAYLGNGLNTLTAANKENVPTGTGSSPTDKAALHPAVTPSQPAPNNRKRKAPATPPAPRPLPTADELEDVIIEGPLTDNCDQVRRKINRALDAGIITKTALAGELGVSVKSLSGFLREHGAYKGQGYSSYPAAWEYFKKLEAVGYKIPNKTSATKKQKTDSAAGSAAGSSSAQAAGASNGAGVDISDVYLEGEETDDVPVYDTCDEIRRKIDAYLKKPGVTMAQFCRDIHAQFHGINRPANIHTSQLSRFRGMKGARAGATSSVFYGAYVFFEKLRIKEKKPMTKHRQDMEEIWPGGFDRTDDGRKGYICFAGERPYMDHYGRITIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.29
4 0.27
5 0.26
6 0.27
7 0.26
8 0.21
9 0.2
10 0.19
11 0.14
12 0.16
13 0.14
14 0.13
15 0.13
16 0.12
17 0.09
18 0.08
19 0.08
20 0.07
21 0.09
22 0.12
23 0.13
24 0.15
25 0.16
26 0.19
27 0.19
28 0.2
29 0.19
30 0.19
31 0.19
32 0.19
33 0.2
34 0.2
35 0.21
36 0.2
37 0.21
38 0.18
39 0.19
40 0.25
41 0.24
42 0.21
43 0.23
44 0.24
45 0.25
46 0.26
47 0.26
48 0.19
49 0.25
50 0.28
51 0.33
52 0.41
53 0.48
54 0.58
55 0.6
56 0.68
57 0.66
58 0.69
59 0.72
60 0.72
61 0.72
62 0.71
63 0.77
64 0.74
65 0.76
66 0.71
67 0.62
68 0.55
69 0.49
70 0.43
71 0.36
72 0.33
73 0.27
74 0.26
75 0.24
76 0.21
77 0.17
78 0.13
79 0.11
80 0.07
81 0.05
82 0.04
83 0.04
84 0.04
85 0.08
86 0.08
87 0.1
88 0.1
89 0.17
90 0.18
91 0.23
92 0.33
93 0.34
94 0.39
95 0.44
96 0.49
97 0.49
98 0.51
99 0.47
100 0.38
101 0.36
102 0.32
103 0.25
104 0.2
105 0.13
106 0.1
107 0.09
108 0.06
109 0.05
110 0.04
111 0.03
112 0.03
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.06
121 0.05
122 0.07
123 0.08
124 0.08
125 0.13
126 0.13
127 0.14
128 0.14
129 0.16
130 0.13
131 0.14
132 0.15
133 0.11
134 0.11
135 0.12
136 0.13
137 0.12
138 0.12
139 0.11
140 0.1
141 0.11
142 0.12
143 0.11
144 0.13
145 0.13
146 0.13
147 0.14
148 0.13
149 0.15
150 0.15
151 0.18
152 0.19
153 0.22
154 0.26
155 0.27
156 0.27
157 0.27
158 0.28
159 0.29
160 0.33
161 0.39
162 0.45
163 0.5
164 0.53
165 0.54
166 0.56
167 0.54
168 0.5
169 0.41
170 0.35
171 0.29
172 0.26
173 0.22
174 0.17
175 0.14
176 0.1
177 0.08
178 0.04
179 0.04
180 0.03
181 0.03
182 0.03
183 0.04
184 0.04
185 0.04
186 0.04
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.04
203 0.04
204 0.04
205 0.04
206 0.04
207 0.06
208 0.06
209 0.07
210 0.07
211 0.07
212 0.07
213 0.14
214 0.15
215 0.16
216 0.18
217 0.18
218 0.19
219 0.23
220 0.3
221 0.32
222 0.36
223 0.44
224 0.44
225 0.44
226 0.43
227 0.4
228 0.37
229 0.3
230 0.3
231 0.26
232 0.29
233 0.3
234 0.3
235 0.32
236 0.3
237 0.28
238 0.25
239 0.23
240 0.2
241 0.2
242 0.25
243 0.27
244 0.28
245 0.29
246 0.28
247 0.27
248 0.26
249 0.27
250 0.24
251 0.2
252 0.2
253 0.22
254 0.26
255 0.3
256 0.31
257 0.32
258 0.33
259 0.32
260 0.38
261 0.35
262 0.38
263 0.36
264 0.38
265 0.35
266 0.34
267 0.33
268 0.28
269 0.28
270 0.22
271 0.17
272 0.13
273 0.12
274 0.11
275 0.11
276 0.09
277 0.09
278 0.11
279 0.11
280 0.1
281 0.15
282 0.18
283 0.2
284 0.3
285 0.35
286 0.38
287 0.46
288 0.56
289 0.62
290 0.7
291 0.78
292 0.79
293 0.82
294 0.87
295 0.85
296 0.81
297 0.75
298 0.69
299 0.65
300 0.63
301 0.53
302 0.44
303 0.37
304 0.31
305 0.28
306 0.23
307 0.17
308 0.13
309 0.18
310 0.23
311 0.24
312 0.27
313 0.29
314 0.3
315 0.33
316 0.31
317 0.28
318 0.25
319 0.27
320 0.27
321 0.3
322 0.31
323 0.3
324 0.3
325 0.3
326 0.34
327 0.31
328 0.32
329 0.27