Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AS12

Protein Details
Accession A0A2T3AS12   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
169-192TSQATKPSVAKRRKPWEKDLPEDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MTEQSSVPDNTEIFKQLEEYQWDKDPQFQGGLSAILGNAKDPNQVQELTLRAQCFYLSRKKSISIDFDAYKAYLAAKHTAQVPTAQVPSETAPQSTPTATSSEHAGNAHDELDVPPASPSPDTNTTTPPPSSDKGAAAPYPPTFAEIVELITSGAPIPGIKEIPPTLLTSQATKPSVAKRRKPWEKDLPEDVVQGVGMQEGEGDQRNVEGTFGDRRDKIVIQDLPEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.24
5 0.28
6 0.29
7 0.3
8 0.34
9 0.37
10 0.35
11 0.39
12 0.36
13 0.32
14 0.31
15 0.27
16 0.23
17 0.21
18 0.21
19 0.13
20 0.12
21 0.09
22 0.09
23 0.09
24 0.08
25 0.09
26 0.09
27 0.12
28 0.13
29 0.15
30 0.17
31 0.17
32 0.17
33 0.19
34 0.2
35 0.21
36 0.23
37 0.2
38 0.18
39 0.18
40 0.18
41 0.17
42 0.2
43 0.27
44 0.28
45 0.31
46 0.33
47 0.36
48 0.4
49 0.43
50 0.43
51 0.38
52 0.39
53 0.36
54 0.35
55 0.32
56 0.28
57 0.22
58 0.17
59 0.12
60 0.09
61 0.1
62 0.12
63 0.12
64 0.13
65 0.16
66 0.17
67 0.17
68 0.16
69 0.16
70 0.16
71 0.16
72 0.15
73 0.12
74 0.12
75 0.13
76 0.16
77 0.14
78 0.12
79 0.12
80 0.14
81 0.15
82 0.14
83 0.13
84 0.1
85 0.11
86 0.11
87 0.11
88 0.12
89 0.11
90 0.12
91 0.12
92 0.11
93 0.1
94 0.1
95 0.1
96 0.07
97 0.07
98 0.06
99 0.08
100 0.08
101 0.07
102 0.07
103 0.07
104 0.07
105 0.07
106 0.07
107 0.1
108 0.15
109 0.17
110 0.18
111 0.22
112 0.23
113 0.25
114 0.25
115 0.22
116 0.21
117 0.2
118 0.22
119 0.2
120 0.19
121 0.19
122 0.2
123 0.19
124 0.16
125 0.17
126 0.14
127 0.14
128 0.13
129 0.13
130 0.11
131 0.1
132 0.11
133 0.09
134 0.09
135 0.07
136 0.08
137 0.06
138 0.06
139 0.06
140 0.05
141 0.04
142 0.04
143 0.03
144 0.04
145 0.06
146 0.07
147 0.07
148 0.1
149 0.11
150 0.13
151 0.14
152 0.15
153 0.15
154 0.18
155 0.19
156 0.19
157 0.22
158 0.26
159 0.26
160 0.24
161 0.27
162 0.32
163 0.41
164 0.47
165 0.53
166 0.57
167 0.68
168 0.77
169 0.81
170 0.81
171 0.83
172 0.82
173 0.81
174 0.76
175 0.71
176 0.62
177 0.56
178 0.46
179 0.35
180 0.26
181 0.19
182 0.13
183 0.07
184 0.06
185 0.05
186 0.04
187 0.04
188 0.07
189 0.09
190 0.09
191 0.09
192 0.09
193 0.11
194 0.11
195 0.11
196 0.09
197 0.1
198 0.17
199 0.2
200 0.26
201 0.25
202 0.27
203 0.32
204 0.33
205 0.33
206 0.35
207 0.36