Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3B6M6

Protein Details
Accession A0A2T3B6M6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
54-74VTNKVYKKPKPVKGAVKGAKKHydrophilic
NLS Segment(s)
PositionSequence
60-74KKPKPVKGAVKGAKK
Subcellular Location(s) extr 8, cyto 7, mito 6, E.R. 4, cyto_pero 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGQGFSGPNAFKWLGFTPKATAVLQADPFLFTALILVLLGCTSLVLLAVYIHFVTNKVYKKPKPVKGAVKGAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.26
4 0.24
5 0.27
6 0.29
7 0.25
8 0.24
9 0.2
10 0.22
11 0.21
12 0.19
13 0.16
14 0.14
15 0.14
16 0.12
17 0.1
18 0.06
19 0.05
20 0.04
21 0.04
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.03
35 0.03
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.08
42 0.15
43 0.19
44 0.26
45 0.35
46 0.39
47 0.5
48 0.6
49 0.66
50 0.69
51 0.74
52 0.78
53 0.78
54 0.85