Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3BAC2

Protein Details
Accession A0A2T3BAC2    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
142-179SEVEGAKPDKKPRKEEKKPKSKEEKRKRRDKKHKEAEEBasic
NLS Segment(s)
PositionSequence
148-176KPDKKPRKEEKKPKSKEEKRKRRDKKHKE
Subcellular Location(s) nucl 20.5, mito_nucl 13, mito 4.5
Family & Domain DBs
Amino Acid Sequences MSAFPSHRSVPSIPVSQDIALKYLQTYLEATKSSPYLLPNARLEPSGPTADSSDSSVTIYNLKRVEAGLRGEWLAPTLDLEDNTTQAANGLAAAPGNNADDQMETDGWQDLDEYQREQQVMQGGEGPTETADARDEDSELDSEVEGAKPDKKPRKEEKKPKSKEEKRKRRDKKHKEAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.3
4 0.32
5 0.27
6 0.23
7 0.18
8 0.17
9 0.14
10 0.15
11 0.14
12 0.12
13 0.13
14 0.13
15 0.16
16 0.16
17 0.17
18 0.17
19 0.17
20 0.17
21 0.17
22 0.16
23 0.2
24 0.23
25 0.27
26 0.28
27 0.3
28 0.3
29 0.28
30 0.28
31 0.24
32 0.24
33 0.21
34 0.18
35 0.16
36 0.16
37 0.17
38 0.17
39 0.15
40 0.13
41 0.11
42 0.11
43 0.11
44 0.1
45 0.14
46 0.14
47 0.17
48 0.17
49 0.16
50 0.16
51 0.16
52 0.17
53 0.16
54 0.17
55 0.14
56 0.14
57 0.14
58 0.14
59 0.13
60 0.12
61 0.09
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.06
73 0.06
74 0.06
75 0.04
76 0.04
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.05
89 0.07
90 0.06
91 0.06
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.06
98 0.09
99 0.09
100 0.1
101 0.11
102 0.13
103 0.13
104 0.13
105 0.14
106 0.16
107 0.16
108 0.15
109 0.18
110 0.16
111 0.16
112 0.16
113 0.14
114 0.09
115 0.09
116 0.09
117 0.05
118 0.06
119 0.07
120 0.09
121 0.09
122 0.09
123 0.09
124 0.1
125 0.1
126 0.1
127 0.09
128 0.08
129 0.08
130 0.08
131 0.08
132 0.08
133 0.09
134 0.13
135 0.18
136 0.28
137 0.38
138 0.45
139 0.54
140 0.65
141 0.74
142 0.81
143 0.87
144 0.89
145 0.9
146 0.92
147 0.93
148 0.93
149 0.92
150 0.92
151 0.93
152 0.93
153 0.92
154 0.95
155 0.95
156 0.95
157 0.96
158 0.96
159 0.96