Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3BAI3

Protein Details
Accession A0A2T3BAI3    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
108-134FLSRIRTRKGRATLQRRKAKRRSTLSHHydrophilic
NLS Segment(s)
PositionSequence
102-130RKRRHGFLSRIRTRKGRATLQRRKAKRRS
Subcellular Location(s) mito 15, nucl 8, extr 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLCLRCSRGLGASTISSIASRAVQKPVIKASSQRTFTSLTPLRPTISASGFRPSLAISTPAASASVEAPLDLLPKISSHPALGATQIRCGPRNTFSPSHFVRKRRHGFLSRIRTRKGRATLQRRKAKRRSTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.13
4 0.12
5 0.11
6 0.12
7 0.14
8 0.16
9 0.19
10 0.24
11 0.26
12 0.29
13 0.34
14 0.33
15 0.31
16 0.34
17 0.38
18 0.42
19 0.44
20 0.41
21 0.37
22 0.37
23 0.36
24 0.41
25 0.37
26 0.31
27 0.32
28 0.32
29 0.31
30 0.28
31 0.29
32 0.23
33 0.22
34 0.22
35 0.19
36 0.21
37 0.2
38 0.2
39 0.19
40 0.16
41 0.13
42 0.11
43 0.11
44 0.08
45 0.08
46 0.09
47 0.08
48 0.08
49 0.07
50 0.07
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.05
59 0.05
60 0.04
61 0.05
62 0.06
63 0.07
64 0.08
65 0.07
66 0.08
67 0.09
68 0.09
69 0.11
70 0.15
71 0.14
72 0.16
73 0.19
74 0.2
75 0.2
76 0.22
77 0.23
78 0.22
79 0.27
80 0.31
81 0.32
82 0.32
83 0.38
84 0.4
85 0.47
86 0.5
87 0.52
88 0.54
89 0.6
90 0.67
91 0.66
92 0.71
93 0.68
94 0.72
95 0.75
96 0.78
97 0.77
98 0.75
99 0.73
100 0.71
101 0.68
102 0.68
103 0.65
104 0.65
105 0.66
106 0.7
107 0.76
108 0.81
109 0.86
110 0.87
111 0.9
112 0.89
113 0.89
114 0.88