Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5IMU8

Protein Details
Accession V5IMU8    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-45EEQPVKRGRGRPPKDPSERKTVPKPSGRPRGRPKGSGBasic
NLS Segment(s)
PositionSequence
14-126KRGRGRPPKDPSERKTVPKPSGRPRGRPKGSGGVKKATQKTAASTNSRRGRPPKSAATPVAAKKAAAPKATPSSTGRGRGRPRKSDVSEAATPSSKKPTPKKGGPGRRGRPPK
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003712  F:transcription coregulator activity  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MAPTKPQSEEQPVKRGRGRPPKDPSERKTVPKPSGRPRGRPKGSGGVKKATQKTAASTNSRRGRPPKSAATPVAAKKAAAPKATPSSTGRGRGRPRKSDVSEAATPSSKKPTPKKGGPGRRGRPPKAATEQSAEEEDGEEAVANEEDADEADKVASDAASDVDEAASDENNNFKDAFGDVDMTLNGLDPSDIEATGEEDIPIDSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.67
3 0.67
4 0.69
5 0.69
6 0.68
7 0.74
8 0.77
9 0.81
10 0.84
11 0.78
12 0.78
13 0.78
14 0.75
15 0.76
16 0.75
17 0.73
18 0.72
19 0.76
20 0.76
21 0.81
22 0.8
23 0.81
24 0.82
25 0.84
26 0.81
27 0.75
28 0.71
29 0.7
30 0.72
31 0.7
32 0.64
33 0.6
34 0.58
35 0.63
36 0.61
37 0.54
38 0.49
39 0.41
40 0.4
41 0.42
42 0.43
43 0.42
44 0.42
45 0.48
46 0.52
47 0.53
48 0.56
49 0.55
50 0.55
51 0.56
52 0.58
53 0.58
54 0.56
55 0.6
56 0.55
57 0.52
58 0.52
59 0.46
60 0.44
61 0.35
62 0.29
63 0.27
64 0.32
65 0.32
66 0.27
67 0.26
68 0.25
69 0.31
70 0.31
71 0.3
72 0.25
73 0.27
74 0.29
75 0.36
76 0.35
77 0.36
78 0.44
79 0.51
80 0.56
81 0.57
82 0.6
83 0.61
84 0.61
85 0.6
86 0.54
87 0.51
88 0.46
89 0.4
90 0.36
91 0.29
92 0.26
93 0.21
94 0.24
95 0.2
96 0.25
97 0.31
98 0.4
99 0.47
100 0.51
101 0.6
102 0.65
103 0.73
104 0.75
105 0.79
106 0.74
107 0.76
108 0.79
109 0.73
110 0.71
111 0.64
112 0.62
113 0.59
114 0.57
115 0.49
116 0.45
117 0.43
118 0.35
119 0.34
120 0.27
121 0.19
122 0.16
123 0.13
124 0.09
125 0.08
126 0.06
127 0.04
128 0.05
129 0.05
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.04
144 0.04
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.06
153 0.06
154 0.06
155 0.06
156 0.1
157 0.11
158 0.12
159 0.12
160 0.11
161 0.12
162 0.12
163 0.14
164 0.11
165 0.13
166 0.12
167 0.13
168 0.12
169 0.12
170 0.11
171 0.09
172 0.08
173 0.06
174 0.06
175 0.05
176 0.08
177 0.09
178 0.09
179 0.09
180 0.09
181 0.11
182 0.12
183 0.12
184 0.09
185 0.08