Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3ARX3

Protein Details
Accession A0A2T3ARX3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
136-156VDEFERKEYLRKNRRRPIEETBasic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 6.5, extr 6, mito 2, plas 2, pero 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039205  NDUFA11  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0032981  P:mitochondrial respiratory chain complex I assembly  
Pfam View protein in Pfam  
PF02466  Tim17  
Amino Acid Sequences MASGDHTYHPQDAVKAGIQGALVTGAAGTLVSAVQNTLAKRNVSAWGVFTRTGGTIAIFAAMGGTYEFTRLASANLREKEDSWNTALGGFLAGSLIGLKHGKPPAVIGFGALSAIVLGVYDYTGGSLTGFKKDRDVDEFERKEYLRKNRRRPIEETISELGEGRGIYAPGYAERRRERLKEKYGIDVPANA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.17
4 0.16
5 0.14
6 0.13
7 0.12
8 0.09
9 0.07
10 0.06
11 0.05
12 0.04
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.06
22 0.09
23 0.1
24 0.14
25 0.17
26 0.18
27 0.19
28 0.21
29 0.23
30 0.22
31 0.21
32 0.2
33 0.19
34 0.21
35 0.2
36 0.18
37 0.16
38 0.14
39 0.14
40 0.12
41 0.09
42 0.07
43 0.07
44 0.07
45 0.06
46 0.05
47 0.04
48 0.04
49 0.04
50 0.03
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.06
57 0.06
58 0.07
59 0.1
60 0.14
61 0.21
62 0.22
63 0.24
64 0.24
65 0.25
66 0.29
67 0.28
68 0.26
69 0.2
70 0.19
71 0.17
72 0.17
73 0.16
74 0.1
75 0.08
76 0.06
77 0.04
78 0.03
79 0.03
80 0.02
81 0.02
82 0.02
83 0.03
84 0.04
85 0.04
86 0.08
87 0.1
88 0.1
89 0.1
90 0.12
91 0.13
92 0.14
93 0.14
94 0.1
95 0.09
96 0.09
97 0.09
98 0.07
99 0.05
100 0.03
101 0.03
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.03
110 0.03
111 0.03
112 0.04
113 0.06
114 0.08
115 0.14
116 0.16
117 0.16
118 0.2
119 0.22
120 0.25
121 0.27
122 0.33
123 0.34
124 0.43
125 0.44
126 0.41
127 0.43
128 0.41
129 0.41
130 0.42
131 0.47
132 0.47
133 0.55
134 0.65
135 0.7
136 0.8
137 0.81
138 0.79
139 0.78
140 0.77
141 0.69
142 0.64
143 0.57
144 0.48
145 0.42
146 0.36
147 0.27
148 0.18
149 0.15
150 0.11
151 0.1
152 0.09
153 0.09
154 0.09
155 0.1
156 0.13
157 0.2
158 0.21
159 0.28
160 0.33
161 0.41
162 0.48
163 0.55
164 0.59
165 0.63
166 0.7
167 0.71
168 0.68
169 0.7
170 0.67
171 0.64