Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3BFQ0

Protein Details
Accession A0A2T3BFQ0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
77-119MDTPKVHIHDRKRHNKESKIKKSTKKKQHRKKKRRKEGSSTTNBasic
NLS Segment(s)
PositionSequence
86-113DRKRHNKESKIKKSTKKKQHRKKKRRKE
Subcellular Location(s) nucl 12, mito 7.5, cyto_mito 5.5, cyto 2.5, plas 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYWLSHWQIPTSPSKCRNINQTVTCNFALYGNATNLSPDQKILPNNDITDKTVPYTIMRAFITNAIIALILSFALLMDTPKVHIHDRKRHNKESKIKKSTKKKQHRKKKRRKEGSSTTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.55
4 0.61
5 0.59
6 0.64
7 0.62
8 0.64
9 0.58
10 0.57
11 0.53
12 0.44
13 0.36
14 0.28
15 0.22
16 0.16
17 0.16
18 0.12
19 0.12
20 0.11
21 0.12
22 0.12
23 0.13
24 0.12
25 0.1
26 0.11
27 0.14
28 0.17
29 0.2
30 0.22
31 0.22
32 0.23
33 0.25
34 0.24
35 0.23
36 0.22
37 0.19
38 0.17
39 0.16
40 0.15
41 0.12
42 0.14
43 0.12
44 0.13
45 0.12
46 0.12
47 0.12
48 0.12
49 0.12
50 0.09
51 0.09
52 0.06
53 0.05
54 0.05
55 0.04
56 0.03
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.03
64 0.04
65 0.04
66 0.06
67 0.07
68 0.1
69 0.14
70 0.21
71 0.3
72 0.39
73 0.5
74 0.6
75 0.67
76 0.75
77 0.8
78 0.84
79 0.85
80 0.86
81 0.87
82 0.87
83 0.87
84 0.87
85 0.89
86 0.9
87 0.91
88 0.91
89 0.91
90 0.92
91 0.94
92 0.96
93 0.96
94 0.97
95 0.97
96 0.97
97 0.97
98 0.96
99 0.95