Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AC74

Protein Details
Accession A0A2T3AC74    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
226-255DNEEKGQQEKRKRPGKKRRIAMRVRTKAEQBasic
268-300KEEHLAEKKKRLNRERKLKRRAKEREKKATGGDBasic
NLS Segment(s)
PositionSequence
218-296TRRPKTGADNEEKGQQEKRKRPGKKRRIAMRVRTKAEQVKKENEDKQKMSKEEHLAEKKKRLNRERKLKRRAKEREKKA
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MFEVPNSKRVRREELYASSSDDGSHDGNRQQTAKDDAEDLDVRAKLNERLSQLLGLDLSSTTEPAAAEQHQPPAVAAAAAAAAAAETPATDNEQQPQDGAGEEHEDKHEEEFEFRLFSTSAKTTAPAKVILTASDDEDADMGDGAFTVPARPRAYYLLGEPTVEELERYRCAAVAGEDIVLGARKRAWGMERPWRVVRITASGEAIKGDNAEAKPGSTRRPKTGADNEEKGQQEKRKRPGKKRRIAMRVRTKAEQVKKENEDKQKMSKEEHLAEKKKRLNRERKLKRRAKEREKKATGGDENGAQQGPGAAADSGSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.53
4 0.51
5 0.43
6 0.39
7 0.33
8 0.25
9 0.2
10 0.17
11 0.18
12 0.18
13 0.2
14 0.24
15 0.27
16 0.29
17 0.27
18 0.29
19 0.33
20 0.32
21 0.3
22 0.28
23 0.25
24 0.28
25 0.28
26 0.25
27 0.23
28 0.21
29 0.2
30 0.2
31 0.22
32 0.21
33 0.25
34 0.28
35 0.26
36 0.29
37 0.3
38 0.3
39 0.28
40 0.24
41 0.2
42 0.15
43 0.13
44 0.09
45 0.09
46 0.08
47 0.08
48 0.07
49 0.08
50 0.07
51 0.08
52 0.1
53 0.11
54 0.15
55 0.17
56 0.2
57 0.2
58 0.2
59 0.19
60 0.18
61 0.16
62 0.11
63 0.09
64 0.06
65 0.05
66 0.05
67 0.04
68 0.03
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.03
75 0.04
76 0.07
77 0.09
78 0.1
79 0.14
80 0.16
81 0.16
82 0.16
83 0.16
84 0.14
85 0.13
86 0.12
87 0.08
88 0.1
89 0.11
90 0.12
91 0.12
92 0.13
93 0.13
94 0.14
95 0.16
96 0.12
97 0.13
98 0.13
99 0.13
100 0.12
101 0.12
102 0.12
103 0.1
104 0.1
105 0.12
106 0.12
107 0.13
108 0.12
109 0.14
110 0.14
111 0.17
112 0.18
113 0.16
114 0.15
115 0.17
116 0.17
117 0.16
118 0.16
119 0.14
120 0.13
121 0.12
122 0.12
123 0.08
124 0.08
125 0.07
126 0.05
127 0.04
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.04
135 0.05
136 0.09
137 0.11
138 0.11
139 0.12
140 0.15
141 0.17
142 0.17
143 0.17
144 0.17
145 0.16
146 0.16
147 0.15
148 0.13
149 0.11
150 0.1
151 0.09
152 0.06
153 0.08
154 0.09
155 0.09
156 0.08
157 0.08
158 0.09
159 0.09
160 0.09
161 0.08
162 0.07
163 0.07
164 0.06
165 0.06
166 0.06
167 0.06
168 0.05
169 0.05
170 0.05
171 0.05
172 0.06
173 0.08
174 0.1
175 0.16
176 0.22
177 0.32
178 0.36
179 0.4
180 0.42
181 0.42
182 0.39
183 0.36
184 0.31
185 0.26
186 0.24
187 0.21
188 0.21
189 0.19
190 0.18
191 0.17
192 0.15
193 0.1
194 0.08
195 0.07
196 0.1
197 0.1
198 0.12
199 0.11
200 0.11
201 0.15
202 0.17
203 0.24
204 0.3
205 0.33
206 0.37
207 0.43
208 0.44
209 0.49
210 0.57
211 0.58
212 0.56
213 0.57
214 0.53
215 0.53
216 0.53
217 0.46
218 0.43
219 0.41
220 0.44
221 0.48
222 0.57
223 0.6
224 0.69
225 0.78
226 0.83
227 0.87
228 0.87
229 0.89
230 0.89
231 0.9
232 0.9
233 0.9
234 0.9
235 0.88
236 0.83
237 0.76
238 0.72
239 0.7
240 0.69
241 0.68
242 0.64
243 0.63
244 0.65
245 0.7
246 0.72
247 0.73
248 0.72
249 0.68
250 0.7
251 0.69
252 0.66
253 0.63
254 0.62
255 0.59
256 0.57
257 0.63
258 0.63
259 0.64
260 0.67
261 0.72
262 0.72
263 0.71
264 0.76
265 0.76
266 0.77
267 0.8
268 0.84
269 0.86
270 0.89
271 0.94
272 0.92
273 0.91
274 0.91
275 0.91
276 0.91
277 0.91
278 0.91
279 0.91
280 0.88
281 0.84
282 0.79
283 0.77
284 0.7
285 0.64
286 0.55
287 0.47
288 0.43
289 0.4
290 0.34
291 0.24
292 0.2
293 0.16
294 0.13
295 0.1
296 0.09
297 0.07