Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ABG1

Protein Details
Accession A0A2T3ABG1   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
98-125AEDASRKLEKTKKRQQHFPQRKYAIKASHydrophilic
NLS Segment(s)
PositionSequence
90-113RAIRRRLSAEDASRKLEKTKKRQQ
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSSKIKAGQLWSKNREDLTKTLGELKTELGQLRIQKIASSGTKLNKIHDLRKSIARVLTIINAKQRHHMRLFYKNKKYLPLDLRPKYTRAIRRRLSAEDASRKLEKTKKRQQHFPQRKYAIKASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.54
4 0.49
5 0.43
6 0.39
7 0.35
8 0.32
9 0.36
10 0.35
11 0.31
12 0.27
13 0.26
14 0.23
15 0.22
16 0.22
17 0.16
18 0.18
19 0.2
20 0.21
21 0.21
22 0.19
23 0.17
24 0.18
25 0.2
26 0.19
27 0.2
28 0.21
29 0.23
30 0.3
31 0.3
32 0.31
33 0.35
34 0.37
35 0.4
36 0.41
37 0.42
38 0.38
39 0.43
40 0.43
41 0.37
42 0.35
43 0.29
44 0.24
45 0.2
46 0.22
47 0.18
48 0.17
49 0.2
50 0.21
51 0.21
52 0.27
53 0.3
54 0.31
55 0.31
56 0.36
57 0.36
58 0.44
59 0.54
60 0.57
61 0.63
62 0.64
63 0.63
64 0.64
65 0.62
66 0.6
67 0.56
68 0.56
69 0.58
70 0.56
71 0.61
72 0.57
73 0.56
74 0.52
75 0.53
76 0.53
77 0.5
78 0.56
79 0.54
80 0.59
81 0.62
82 0.62
83 0.6
84 0.57
85 0.58
86 0.57
87 0.54
88 0.52
89 0.5
90 0.47
91 0.47
92 0.48
93 0.49
94 0.51
95 0.59
96 0.65
97 0.71
98 0.8
99 0.85
100 0.89
101 0.9
102 0.88
103 0.88
104 0.87
105 0.86
106 0.82