Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7RVK8

Protein Details
Accession Q7RVK8    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
73-93ECSVCKQKKQLPLKRCKHFELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 8, cyto 8, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncr:NCU00706  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCAGRSCGKHTLHKVTQYKAGKASAFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECSVCKQKKQLPLKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.64
4 0.67
5 0.61
6 0.6
7 0.57
8 0.61
9 0.58
10 0.62
11 0.62
12 0.57
13 0.62
14 0.58
15 0.53
16 0.47
17 0.44
18 0.35
19 0.32
20 0.31
21 0.3
22 0.3
23 0.29
24 0.34
25 0.38
26 0.42
27 0.47
28 0.52
29 0.49
30 0.55
31 0.62
32 0.6
33 0.61
34 0.59
35 0.58
36 0.57
37 0.59
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.62
58 0.59
59 0.57
60 0.52
61 0.48
62 0.5
63 0.46
64 0.43
65 0.45
66 0.47
67 0.52
68 0.61
69 0.65
70 0.66
71 0.74
72 0.79
73 0.83
74 0.83
75 0.78
76 0.74
77 0.68
78 0.65
79 0.65
80 0.64
81 0.62
82 0.61
83 0.56
84 0.51
85 0.48
86 0.42