Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7SHV3

Protein Details
Accession Q7SHV3    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-65AEEFRRIKRRQNKPAAPGSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0071013  C:catalytic step 2 spliceosome  
GO:0005737  C:cytoplasm  
GO:0005685  C:U1 snRNP  
GO:0005686  C:U2 snRNP  
GO:0071004  C:U2-type prespliceosome  
GO:0005687  C:U4 snRNP  
GO:0046540  C:U4/U6 x U5 tri-snRNP complex  
GO:0005682  C:U5 snRNP  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG ncr:NCU02508  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01717  Sm_B  
Amino Acid Sequences MASTNKQGKMAGYINYRMRVTLNDGRQMTGQMLAFDKHMNLVLADAEEFRRIKRRQNKPAAPGSSAPAVQTVEQEEKRTLGLTIIRGAHIVSLSVESPPPADPSARLGKSTGGGLASTLQAGPGVARPAGRGAAAPISLAGPAAGVGGAAPPPPFPGFPGAAPPGFPGRGGPPPPGFPVFPPAAGFPGAPGFPPSFPPPGAGGPAGFNPPPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.43
4 0.37
5 0.35
6 0.31
7 0.34
8 0.35
9 0.35
10 0.39
11 0.39
12 0.4
13 0.39
14 0.38
15 0.31
16 0.26
17 0.21
18 0.15
19 0.16
20 0.15
21 0.15
22 0.15
23 0.14
24 0.11
25 0.12
26 0.11
27 0.09
28 0.09
29 0.08
30 0.08
31 0.08
32 0.08
33 0.08
34 0.11
35 0.12
36 0.13
37 0.22
38 0.23
39 0.33
40 0.43
41 0.53
42 0.6
43 0.71
44 0.77
45 0.76
46 0.83
47 0.77
48 0.69
49 0.6
50 0.51
51 0.42
52 0.34
53 0.27
54 0.19
55 0.16
56 0.13
57 0.13
58 0.13
59 0.16
60 0.17
61 0.19
62 0.18
63 0.18
64 0.17
65 0.17
66 0.14
67 0.1
68 0.12
69 0.11
70 0.14
71 0.14
72 0.13
73 0.13
74 0.13
75 0.11
76 0.09
77 0.08
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.05
84 0.06
85 0.06
86 0.08
87 0.07
88 0.07
89 0.08
90 0.12
91 0.19
92 0.19
93 0.19
94 0.18
95 0.18
96 0.18
97 0.18
98 0.14
99 0.07
100 0.06
101 0.06
102 0.07
103 0.06
104 0.05
105 0.05
106 0.04
107 0.04
108 0.04
109 0.04
110 0.05
111 0.05
112 0.06
113 0.06
114 0.07
115 0.08
116 0.08
117 0.08
118 0.07
119 0.07
120 0.08
121 0.08
122 0.07
123 0.07
124 0.06
125 0.06
126 0.06
127 0.05
128 0.03
129 0.03
130 0.03
131 0.03
132 0.02
133 0.02
134 0.03
135 0.03
136 0.04
137 0.04
138 0.04
139 0.07
140 0.08
141 0.08
142 0.09
143 0.13
144 0.14
145 0.14
146 0.19
147 0.2
148 0.19
149 0.19
150 0.19
151 0.19
152 0.18
153 0.17
154 0.14
155 0.15
156 0.22
157 0.24
158 0.28
159 0.27
160 0.29
161 0.33
162 0.34
163 0.31
164 0.26
165 0.3
166 0.26
167 0.24
168 0.23
169 0.2
170 0.19
171 0.19
172 0.18
173 0.12
174 0.14
175 0.13
176 0.12
177 0.14
178 0.14
179 0.14
180 0.18
181 0.21
182 0.22
183 0.22
184 0.24
185 0.25
186 0.25
187 0.27
188 0.24
189 0.21
190 0.19
191 0.21
192 0.23
193 0.21