Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AC59

Protein Details
Accession A0A2T3AC59   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
49-77SSPSHQCCPHHKKQRKKGRDIRRIHCNCNHydrophilic
NLS Segment(s)
PositionSequence
60-68KKQRKKGRD
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, cyto 3.5, cysk 3, mito 2, plas 2
Family & Domain DBs
Amino Acid Sequences MTLHIIQCIHGLGLSDPSMPTIVILWTRIQVLHSTETRAPAVVLFFFGSSPSHQCCPHHKKQRKKGRDIRRIHCNCNLESCVICLTINYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.11
5 0.11
6 0.1
7 0.09
8 0.07
9 0.08
10 0.08
11 0.09
12 0.09
13 0.09
14 0.1
15 0.1
16 0.1
17 0.11
18 0.12
19 0.15
20 0.15
21 0.18
22 0.18
23 0.2
24 0.19
25 0.18
26 0.15
27 0.11
28 0.11
29 0.08
30 0.07
31 0.06
32 0.05
33 0.05
34 0.06
35 0.06
36 0.07
37 0.09
38 0.11
39 0.13
40 0.15
41 0.18
42 0.28
43 0.36
44 0.46
45 0.54
46 0.61
47 0.7
48 0.79
49 0.88
50 0.88
51 0.9
52 0.9
53 0.9
54 0.91
55 0.9
56 0.87
57 0.87
58 0.83
59 0.78
60 0.76
61 0.69
62 0.6
63 0.57
64 0.51
65 0.42
66 0.36
67 0.32
68 0.25
69 0.21
70 0.2