Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3AH35

Protein Details
Accession A0A2T3AH35    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
228-250SATGKRKKAKPDAAPDKRQRRIDBasic
NLS Segment(s)
PositionSequence
232-247KRKKAKPDAAPDKRQR
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020993  Centromere_CenpK  
Gene Ontology GO:0000775  C:chromosome, centromeric region  
GO:0005634  C:nucleus  
GO:0051382  P:kinetochore assembly  
Amino Acid Sequences MEAATELLGSEDLHTTYLERSRKELETKIAQLKRSLAEENERFAVASSQRRTQDAGKASVIGAKQQLNVIAEAYRRAAATEPFLPFPDSVVPALVALRTTSSTIDESKKFLASQKLSLEKARDRLEAEQASLIDQKALKKALEDRAQSLRDGIESRGGMSPDQIARNKVSGLKTQIKETNTDRSRLLKVLGTFIDNRLAVLLAAEQIGGPVTGEMMDIDSETLDAGFSATGKRKKAKPDAAPDKRQRRIDDMLRDAPHGADDAVQELDRKAAAGEEMQRLVEELMNGLLAAQGSHSDAYISVPEETASVRFLTRVKVAEFHPRNSKRLRLVDFGREIGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.14
4 0.21
5 0.25
6 0.25
7 0.29
8 0.34
9 0.4
10 0.44
11 0.46
12 0.47
13 0.5
14 0.55
15 0.61
16 0.6
17 0.57
18 0.54
19 0.53
20 0.48
21 0.44
22 0.4
23 0.33
24 0.38
25 0.39
26 0.39
27 0.37
28 0.34
29 0.3
30 0.27
31 0.28
32 0.24
33 0.29
34 0.29
35 0.35
36 0.36
37 0.38
38 0.41
39 0.4
40 0.43
41 0.4
42 0.41
43 0.35
44 0.34
45 0.32
46 0.32
47 0.28
48 0.23
49 0.21
50 0.19
51 0.19
52 0.19
53 0.21
54 0.19
55 0.19
56 0.17
57 0.15
58 0.14
59 0.14
60 0.15
61 0.13
62 0.12
63 0.12
64 0.13
65 0.12
66 0.16
67 0.19
68 0.2
69 0.2
70 0.21
71 0.22
72 0.2
73 0.2
74 0.19
75 0.15
76 0.14
77 0.13
78 0.12
79 0.11
80 0.11
81 0.1
82 0.07
83 0.06
84 0.06
85 0.07
86 0.07
87 0.08
88 0.09
89 0.11
90 0.14
91 0.19
92 0.19
93 0.21
94 0.21
95 0.22
96 0.21
97 0.24
98 0.28
99 0.26
100 0.3
101 0.33
102 0.36
103 0.37
104 0.38
105 0.39
106 0.34
107 0.38
108 0.36
109 0.33
110 0.3
111 0.3
112 0.35
113 0.31
114 0.28
115 0.23
116 0.2
117 0.19
118 0.19
119 0.16
120 0.11
121 0.11
122 0.12
123 0.14
124 0.15
125 0.14
126 0.14
127 0.2
128 0.26
129 0.31
130 0.31
131 0.32
132 0.36
133 0.37
134 0.35
135 0.3
136 0.23
137 0.18
138 0.18
139 0.14
140 0.12
141 0.11
142 0.13
143 0.14
144 0.14
145 0.12
146 0.11
147 0.13
148 0.12
149 0.16
150 0.16
151 0.15
152 0.16
153 0.17
154 0.17
155 0.19
156 0.18
157 0.18
158 0.23
159 0.3
160 0.3
161 0.33
162 0.36
163 0.33
164 0.35
165 0.34
166 0.38
167 0.32
168 0.33
169 0.3
170 0.3
171 0.31
172 0.28
173 0.27
174 0.19
175 0.18
176 0.19
177 0.19
178 0.17
179 0.16
180 0.16
181 0.17
182 0.14
183 0.13
184 0.11
185 0.1
186 0.08
187 0.07
188 0.07
189 0.04
190 0.04
191 0.04
192 0.04
193 0.03
194 0.04
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.04
206 0.04
207 0.04
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.07
216 0.13
217 0.18
218 0.22
219 0.28
220 0.33
221 0.42
222 0.52
223 0.59
224 0.61
225 0.68
226 0.75
227 0.79
228 0.84
229 0.85
230 0.85
231 0.83
232 0.8
233 0.72
234 0.67
235 0.66
236 0.64
237 0.63
238 0.6
239 0.6
240 0.55
241 0.53
242 0.47
243 0.38
244 0.3
245 0.22
246 0.15
247 0.09
248 0.08
249 0.09
250 0.1
251 0.1
252 0.1
253 0.09
254 0.1
255 0.09
256 0.09
257 0.07
258 0.07
259 0.07
260 0.1
261 0.14
262 0.17
263 0.17
264 0.17
265 0.17
266 0.17
267 0.17
268 0.15
269 0.11
270 0.08
271 0.07
272 0.07
273 0.07
274 0.06
275 0.06
276 0.05
277 0.05
278 0.04
279 0.05
280 0.06
281 0.07
282 0.07
283 0.06
284 0.07
285 0.08
286 0.1
287 0.11
288 0.1
289 0.1
290 0.1
291 0.11
292 0.12
293 0.11
294 0.11
295 0.1
296 0.1
297 0.12
298 0.13
299 0.17
300 0.2
301 0.23
302 0.24
303 0.27
304 0.29
305 0.39
306 0.42
307 0.44
308 0.51
309 0.52
310 0.57
311 0.6
312 0.65
313 0.63
314 0.68
315 0.67
316 0.65
317 0.66
318 0.69
319 0.66